KEGG   Streptomyces leeuwenhoekii: sle_24810Help
Entry
sle_24810         CDS       T04414                                 

Gene name
sle_24810
Definition
(GenBank) Superoxide dismutase [Ni]
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
sle  Streptomyces leeuwenhoekii
Brite
KEGG Orthology (KO) [BR:sle00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    sle_24810 (sle_24810)
Enzymes [BR:sle01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     sle_24810 (sle_24810)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni BtrH_N
Motif
Other DBs
NCBI-ProteinID: CQR61942
UniProt: A0A0F7VWM1
LinkDB All DBs
Position
chromosome:3018656..3019051
Genome map
AA seq 131 aa AA seqDB search
MLSRLFAPKVKVSAHCDLPCGVYDPAQARIEAESVKAVQEKMAGNDDPHFQARATVIKEQ
RAELAKHHVSVLWSDYFKAPHFEKYPELHQLVNDTLKALSAAKASTDPATGQKALDYIAQ
IDKIFWETKKA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgctttcccgcctgtttgcccccaaggtcaaggtcagcgcgcactgcgacctgccctgc
ggtgtgtacgacccggcccaggcccgcatcgaggcggagtcggtcaaggccgtccaggag
aagatggccggcaacgacgacccgcacttccaggcgcgtgccacggtcatcaaggagcag
cgcgcggagctggccaagcaccacgtctccgtgctgtggagcgactacttcaaggccccg
cacttcgagaagtacccggagctgcaccagctcgtcaacgacaccctgaaggccctctcg
gccgccaaggcgtcgaccgacccggccaccggccagaaggcgctggactacatcgcccag
atcgacaagatcttctgggagaccaagaaggcttga

DBGET integrated database retrieval system