KEGG   Streptomyces leeuwenhoekii: sle_28550Help
Entry
sle_28550         CDS       T04414                                 

Gene name
sle_28550
Definition
(GenBank) Malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
sle  Streptomyces leeuwenhoekii
Pathway
sle00020  Citrate cycle (TCA cycle)
sle00270  Cysteine and methionine metabolism
sle00620  Pyruvate metabolism
sle00630  Glyoxylate and dicarboxylate metabolism
sle00680  Methane metabolism
sle01100  Metabolic pathways
sle01110  Biosynthesis of secondary metabolites
sle01120  Microbial metabolism in diverse environments
sle01130  Biosynthesis of antibiotics
sle01200  Carbon metabolism
Module
sle_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sle_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sle_M00012  Glyoxylate cycle
sle_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    sle_28550 (sle_28550)
   00620 Pyruvate metabolism
    sle_28550 (sle_28550)
   00630 Glyoxylate and dicarboxylate metabolism
    sle_28550 (sle_28550)
  09102 Energy metabolism
   00680 Methane metabolism
    sle_28550 (sle_28550)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    sle_28550 (sle_28550)
Enzymes [BR:sle01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     sle_28550 (sle_28550)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N Stealth_CR1
Motif
Other DBs
NCBI-ProteinID: CQR62316
UniProt: A0A0F7W071
LinkDB All DBs
Position
chromosome:complement(3437021..3438010)
Genome map
AA seq 329 aa AA seqDB search
MTRTPVNVTVTGAAGQIGYALLFRIASGQLLGADVPVKLRLLEITPALKAAEGTAMELDD
CAFPLLQGIEITDDPNVAFDGANVALLVGARPRTKGMERGDLLEANGGIFKPQGKAINDH
AADDIRVLVVGNPANTNALIAQAAAPDVPAERFTAMTRLDHNRALTQLAKKTGSTVADIK
RLTIWGNHSATQYPDIFHATVAGKNAAEVVNDEKWLAEDFIPTVAKRGAAIIEARGASSA
ASAANAAIDHVYSWVNGTPEGDWVSMGIPSDGSYGVPEGLISSFPVTCKDGKYEIVQGLE
INEFSRTRIDASVKELEEEREAVRGLGLI
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcactcccgtgaacgtcaccgtcaccggcgcggccggccagatcggttacgcc
ctgctgttccgcatcgcctccggccagctcctcggcgcggacgtgccggtcaagctccgc
ctgctggagatcaccccggcgctgaaggcggccgagggcacggccatggagctcgacgac
tgcgcgttcccgctgctccagggcatcgagatcaccgacgacccgaacgtcgccttcgac
ggtgccaacgtcgccctcctcgtcggcgcccgcccgcgcaccaagggcatggagcgcggt
gacctgctggaggccaacggcggcatcttcaagccgcagggcaaggccatcaacgaccac
gccgcggacgacatccgcgtcctggtcgtcggcaacccggccaacaccaacgcgctcatc
gcgcaggccgccgccccggacgtaccggccgagcgcttcaccgcgatgacccgcctggac
cacaaccgcgcgctgacccagctcgcgaagaagacgggctccacggtcgccgacatcaag
cggctgaccatctggggcaaccactccgccacgcagtacccggacatcttccacgccacc
gtcgccggcaagaacgccgccgaggtcgtcaacgacgagaagtggctggccgaggacttc
atcccgaccgtcgccaagcgcggcgccgccatcatcgaggcccgcggcgcctcgtcggcc
gcctccgccgccaacgccgccatcgaccacgtctactcctgggtcaacggcacccccgag
ggcgactgggtctccatgggcatcccgtcggacggctcctacggcgtcccggagggcctg
atctcctccttcccggtcacctgcaaggacggcaagtacgagatcgtccagggcctggag
atcaacgagttctcccgcacccgcatcgacgcctccgtcaaggagctggaggaggagcgc
gaggcggtccgcggcctcggcctcatctga

DBGET integrated database retrieval system