KEGG   Streptomyces leeuwenhoekii: sle_41520Help
Entry
sle_41520         CDS       T04414                                 

Gene name
sle_41520
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sle  Streptomyces leeuwenhoekii
Pathway
sle00620  Pyruvate metabolism
sle00680  Methane metabolism
sle01100  Metabolic pathways
sle01120  Microbial metabolism in diverse environments
sle01200  Carbon metabolism
Module
sle_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sle00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    sle_41520 (sle_41520)
  Energy metabolism
   00680 Methane metabolism
    sle_41520 (sle_41520)
Enzymes [BR:sle01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     sle_41520 (sle_41520)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: CQR63611
UniProt: A0A0F7W3F2
LinkDB All DBs
Position
chromosome:4857814..4860555
Genome map
AA seq 913 aa AA seqDB search
MSSADDLTTRSTTTSSELRADIRRLGDLLGETLVRQEGPELLDLVEKVRRLTREDGEAAA
ELLRGTELETAAKLVRAFSTYFHLANITEQVHRGRELRARRAAEGGLIARTADRLKDADP
EHLREAVANLNVRPVFTAHPTEAARRSVLNKLRRVAALLDTPVLESDRRRHDTRLAENID
LVWQTDELRVVRPEPADEARNAIYYLDELHAGAVGDVLEDLTAELERVGVKLPDGTRPLT
FGTWIGGDRDGNPNVTPQVTWDVLILQHEHGINDALETIDELRGLLSNSIRYTGATQELL
DSLQADLERLPEISPRYKRLNAEEPYRLKATCIRQKLENTKKRLADGTPHQPGRDYLGTS
ELLADLRIIQTSLREHRGGLFADGRLARTIRTLGAFGLQLATMDVREHADAHHHALGQLF
DRLGEESWRYADMPREYRAKLLAKELRSRRPLAPTPAPVDAAGEKTLGVFRTVKRALEVF
GPEVIESYIISMCQGADDVFAAAVLAREAGLIDLHVGWAKIGIVPLLETTDELKAADTIL
EDMLSDPSYRRLVALRGDVQEVMLGYSDSSKFGGITTSQWEIHRAQRRLRDVAHRYGVRL
RLFHGRGGTVGRGGGPTHDAILAQPWGTLEGEIKVTEQGEVISDKYLIPSLARENLELTV
AATLQASALHTAPRQSQEALARWDAAMDVVSDAAHAAYRRLVEDPDLPAYFFASTPVDQL
ADLHLGSRPSRRPDSGAGLDGLRAIPWVFGWTQSRQIVPGWFGVGSGLKALREAGLDTVL
EEMYGQWHFFRNFISNVEMTLAKTDLRIAAHYVDTLVPDELRHVFDTIRAEHELTVREVL
RVTGEKGLLDAQPVLKQTFAIRDAYLDPISYLQVALLKRQRDAAAAGEQPDPLLSRALLL
TVNGVAAGLRNTG
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagtgccgacgacctgactacgcggtccacgacgaccagcagcgagctgcgcgcc
gacatccgccggctgggcgacctcctcggggagaccctcgtccggcaggaaggccccgag
ctgctggacctcgtcgagaaggtacgccgcctcacccgcgaagacggggaggccgccgcc
gagctgctgcgcggcacggaactggagaccgcggccaagctggtccgcgccttctccacc
tacttccacctcgccaacatcaccgaacaggtccaccggggccgcgagctgcgcgcccgg
cgcgccgccgagggcggcctgatcgcccgtaccgccgaccggctcaaggacgccgacccc
gagcacctgcgcgaggcggtcgccaacctcaacgtccgccccgtcttcaccgcccacccc
accgaggccgcccgccgctccgtcctcaacaagctgcgccgcgtcgccgccctcctcgac
acccccgtcctggaatccgaccggcgccgccacgacacccggctggccgagaacatcgac
ctcgtctggcagaccgacgaactgcgcgtcgtccgccccgaaccggccgacgaggcccgc
aacgccatctactacctcgacgaactgcacgccggcgccgtcggcgacgtcctggaggac
ctgaccgccgaactggagcgggtcggcgtcaagctccccgacggcacccgccccctcacc
ttcggcacctggatcggcggcgaccgcgacggcaaccccaacgtcaccccccaggtcacc
tgggacgtcctgatcctccagcacgagcacggcatcaacgacgcgctggagaccatcgac
gaactgcgcggcctgctgtccaactccatccgctacaccggcgccacccaggaactgctc
gactccctccaggccgacctggaacggctgcccgagatcagcccccgctacaagcgcctc
aacgccgaggagccctaccggctcaaggccacctgcatccggcagaagctggagaacacc
aagaagcgcctggccgacggcaccccccaccagcccggccgcgactacctcggcaccagc
gaactcctcgccgacctgcgcatcatccagacctccctgcgcgagcaccgcggcggcctc
ttcgccgacggccgcctcgcccgcaccatccgcaccctgggcgccttcggcctccagctc
gccaccatggacgtccgcgaacacgccgacgcccaccaccacgccctcggccagctcttc
gaccggctcggcgaggaatcctggcgctacgccgacatgccccgcgagtaccgcgccaag
ctcctcgccaaggagctcaggtccagaaggcccctggcccccaccccggcgcccgtggac
gccgccggcgagaagaccctcggcgtcttccggaccgtcaagcgcgccctggaggtcttc
ggacccgaggtcatcgagtcgtacatcatctccatgtgccagggcgccgacgacgtcttc
gccgccgccgtcctcgcccgcgaagccggcctcatcgacctccacgtcggctgggccaag
atcggcatcgtgccgctgctggagaccaccgacgaactcaaggccgccgacaccatcctg
gaggacatgctctccgacccgtcctaccggcgcctggtcgcgctgcgcggcgacgtccag
gaggtcatgctcggctactccgactcctccaagttcggcggcatcaccaccagccagtgg
gagatccaccgcgcccagcgccgcctgcgcgacgtcgcccaccgctacggcgtccggctc
cgcctcttccacggccgcggcggcaccgtcggccgcggcggcggccccacccacgacgcc
atcctcgcccagccctggggcaccctcgaaggcgagatcaaggtcaccgaacagggcgag
gtcatctccgacaagtacctcatcccctccctcgcccgggagaacctggaactgacggtc
gccgccaccctccaggcgtccgccctgcacaccgcgccccgccagtcccaggaagccctc
gcccgctgggacgccgccatggacgtcgtctccgacgccgcccacgccgcctaccgccgc
ctggtggaggaccccgacctcccggcgtacttcttcgcctccacccccgtcgaccagctc
gccgacctccacctgggctcccgcccgtcacggcgccccgactccggcgccggcctcgac
ggcctgcgcgccatcccgtgggtgttcggctggacccagtcccggcagatcgtccccggc
tggttcggcgtcggctccggcctcaaggccctgcgcgaggcgggcctggacaccgtgctg
gaggagatgtacggccagtggcacttcttccgcaacttcatctccaacgtcgagatgacg
ctcgccaagaccgacctgcggatcgccgcccactacgtggacaccctggtaccggacgaa
ctgcggcacgtcttcgacaccatccgcgccgaacacgagctgaccgtgcgcgaggtgctc
cgcgtcaccggtgagaagggactgctcgacgcccagcccgtgctcaagcagaccttcgcc
atccgcgacgcctacctcgacccgatctcctacctccaggtcgccctgctcaagcgccag
cgcgacgccgccgccgccggcgaacagcccgacccgctgctgtcgcgggccctgctgctc
accgtcaacggcgtcgccgccggcctgcgcaacaccggctga

DBGET integrated database retrieval system