KEGG   Staphylococcus lugdunensis HKU09-01: SLGD_00543Help
Entry
SLGD_00543        CDS       T01177                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase, R-alcohol forming, (R)- and (S)-acetoin-specific
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
slg  Staphylococcus lugdunensis HKU09-01
Pathway
slg00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:slg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SLGD_00543
Enzymes [BR:slg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     SLGD_00543
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     SLGD_00543
    1.1.1.-  
     SLGD_00543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc AlaDh_PNT_C 2-Hacid_dh_C MTS UDPG_MGDP_dh_N Lyase_1
Motif
Other DBs
NCBI-ProteinID: ADC86691
LinkDB All DBs
Position
complement(603206..604039)
Genome map
AA seq 277 aa AA seqDB search
MKAAVWYGQKDVRVEDREPKVLKDNEVKVKVSWTGICGTDLHEYLEGPVFISTEQPDPLL
GQTAPVTLGHEFSGVVEEVGKDVTKYKKGDRVVVNPTVSRHEKEENIDLYDGYSFIGLGS
DGGFAEFTNAPEENVYALPDNVSAREGALVEPTAVAVQAVKEGNLLFGDKVAVFGAGPIG
LLTVVAAKAAGASKIYVFDLSEERLAKAKEVGATHVVNSGKVNPVEYINEHTDNGVDVTF
EVAGVGVTLQQSVEVTRPRGTVVIVSIFAHPVEFDPM
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcagtatggtatggtcaaaaagatgttcgcgtggaagatcgtgaaccaaaa
gtattaaaagataatgaagttaaggttaaagtatcatggacggggatttgtggtacggac
ttacacgagtatttagaaggtcctgtctttatttctacagaacaacctgaccctttatta
ggtcaaactgcaccagtgacgttaggccatgaattttcaggcgtagttgaagaagtaggt
aaagacgtaactaaatacaaaaaaggggatcgtgttgttgtgaaccctaccgtgtctcga
catgaaaaagaagaaaatatcgatctttatgatggttattcatttattgggttgggatct
gatggtggatttgctgagtttacaaatgcaccagaagaaaatgtttacgcattacctgac
aatgtttcagctagagaaggtgctttagttgaaccaacagccgttgcagtacaagctgtc
aaagaaggcaacttattatttggtgataaagtagctgtctttggtgctggtccaattgga
ttattaacagttgtcgctgctaaagcagctggcgcaagtaaaatctatgtctttgattta
tctgaagaacgcttagctaaagctaaagaagtaggtgcaactcacgtcgttaattctggt
aaagttaatcctgttgaatacatcaacgaacacactgacaacggtgttgatgtcactttt
gaagttgctggcgtcggcgttacgttacaacaatctgttgaagtcactcgcccacgtggg
acagtagtcatcgtctctatctttgcgcacccggttgaatttgatccaatgtga

DBGET integrated database retrieval system