KEGG   Staphylococcus lugdunensis HKU09-01: SLGD_00902Help
Entry
SLGD_00902        CDS       T01177                                 

Definition
(GenBank) Aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
slg  Staphylococcus lugdunensis HKU09-01
Pathway
slg00010  Glycolysis / Gluconeogenesis
slg00053  Ascorbate and aldarate metabolism
slg00071  Fatty acid degradation
slg00280  Valine, leucine and isoleucine degradation
slg00310  Lysine degradation
slg00330  Arginine and proline metabolism
slg00340  Histidine metabolism
slg00380  Tryptophan metabolism
slg00410  beta-Alanine metabolism
slg00561  Glycerolipid metabolism
slg00620  Pyruvate metabolism
slg00625  Chloroalkane and chloroalkene degradation
slg01100  Metabolic pathways
slg01110  Biosynthesis of secondary metabolites
slg01120  Microbial metabolism in diverse environments
slg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:slg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SLGD_00902
   00053 Ascorbate and aldarate metabolism
    SLGD_00902
   00620 Pyruvate metabolism
    SLGD_00902
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SLGD_00902
   00561 Glycerolipid metabolism
    SLGD_00902
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SLGD_00902
   00310 Lysine degradation
    SLGD_00902
   00330 Arginine and proline metabolism
    SLGD_00902
   00340 Histidine metabolism
    SLGD_00902
   00380 Tryptophan metabolism
    SLGD_00902
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SLGD_00902
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SLGD_00902
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SLGD_00902
Enzymes [BR:slg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SLGD_00902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ADC87040
LinkDB All DBs
Position
964441..965868
Genome map
AA seq 475 aa AA seqDB search
MRNFTKQYINGEWVESASNETIDVINPATEEVIGKIAKGNNEDVNKAVQAADEVYLSFRH
SSVDERKALLDKIVAEYKNRKDDIVDAITDELGSPITVSENVHYQMGLNHFQAARDALDT
FQFEEQRGDDLVVKEAIGVAGLVTPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAI
ILAEIFDKVGVPKGVFNLVNGDGEGVGTPLSEHPKVRMMSFTGSGPTGAKIMEKAAHDFK
KVSLELGGKSPYIVLDDVDIKEAAKATKGKVVNNTGQVCTAGTRILVPNSIKEEFLTALK
EEFSQVVVGDPRNEDTEVGPIVSKKQFDTVQSYIDKGIAEGAELFYGGPGKPEGLDVGYF
VRPTVFVNVDNQMTIAQEEIFGPVASVITYNDLDEAIRIANDTKYGLAGYVIGQDKDTLI
KVARSIEAGTVEINEAGRKPDLPFGGYKQSGIGREWGDYGIDEFLEIKSIAGYYK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatttcactaaacaatatataaacggtgaatgggttgaaagtgcgagcaatgaa
acaatagacgttattaatccagccactgaagaagtaatcggtaaaatagcaaaaggaaat
aatgaagatgttaataaagctgtccaagctgcagatgaagtttatttatcatttagacat
agtagcgtggatgaaagaaaagcattgttagataaaattgttgctgaatataagaataga
aaagacgatatcgttgatgccattacagatgaactaggttcacctattacagtatcagaa
aatgtacattatcaaatgggacttaaccatttccaagctgcacgagatgctttagatact
ttccaatttgaagaacaacgtggtgatgatttagttgttaaagaggcaattggtgttgct
ggtttagtcacaccttggaatttcccaacaaatcaaacatcacttaaattagcggcagcg
tttgcagcaggtagtcctgtcgtgttaaaaccgtctgaagagacaccttttgcagcaatt
attttagctgaaattttcgataaagtaggcgttcctaaaggtgtatttaacttggtaaat
ggcgacggtgaaggcgttggtacaccattaagtgaacatccaaaagtaagaatgatgtct
ttcacaggttctggtccaacaggtgccaaaataatggaaaaagctgcgcatgattttaaa
aaagtgtcacttgaattgggaggtaaatcaccttatatcgtccttgatgatgttgatatt
aaagaagctgcaaaagcaacaaaaggtaaagttgttaataatacaggacaagtgtgtaca
gctggaacaagaatattagttcctaatagtattaaagaagaatttttaacggctttaaaa
gaagagttcagtcaagtagtggtaggagatcctcgtaatgaggacactgaagttggccca
atagtaagcaaaaagcaatttgatacggtacaatcctatattgataaaggcattgctgaa
ggcgcagaattgttttacggaggtcctggcaaacctgaaggcttggatgttggctatttt
gttcgtccaacagtatttgtcaatgttgataatcaaatgacaattgcacaagaagaaata
ttcggtccggttgcctctgtgatcacgtataatgatctagatgaagctattcgtatagca
aatgatacaaaatacggtctggctggttatgtgattgggcaagataaagacacattaatt
aaagtagctcgtagcattgaagctggcacagtagaaattaatgaagcaggcagaaaacca
gatttaccattcggcggttataaacaatcaggaattggacgcgaatggggcgattatggt
attgatgaattcttagaaatcaagtctatagctggatattataaataa

DBGET integrated database retrieval system