KEGG   Staphylococcus lugdunensis HKU09-01: SLGD_01780Help
Entry
SLGD_01780        CDS       T01177                                 

Definition
(GenBank) Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
slg  Staphylococcus lugdunensis HKU09-01
Pathway
slg00010  Glycolysis / Gluconeogenesis
slg00020  Citrate cycle (TCA cycle)
slg00620  Pyruvate metabolism
slg01100  Metabolic pathways
slg01110  Biosynthesis of secondary metabolites
slg01120  Microbial metabolism in diverse environments
slg01130  Biosynthesis of antibiotics
slg01200  Carbon metabolism
Module
slg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:slg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SLGD_01780
   00020 Citrate cycle (TCA cycle)
    SLGD_01780
   00620 Pyruvate metabolism
    SLGD_01780
Enzymes [BR:slg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SLGD_01780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N ATP-synt_ab_Xtn DUF896 HlyD_D23
Motif
Other DBs
NCBI-ProteinID: ADC87870
LinkDB All DBs
Position
complement(1849903..1851207)
Genome map
AA seq 434 aa AA seqDB search
MAFEFRLPDIGEGIHEGEIVKWFVKAGDTIEEDDVLAEVQNDKSVVEIPSPVSGTIEEVV
VDEGTVAVVGDVIVKIDAPDAEEMQFKGHDDDSSAKEEPAKEEAKAETEEAPAASASQDE
EVDENRKIKAMPSVRKYAREKGVNIKAVAGSGKNGRITKEDIDNHLNGGGAQAASASNES
AAASTSEETSAPQTQSVPEGDFPETTEKIPAMRRAIAKAMVNSKHTAPHVTLMDEIDVQD
LWDHRKKFKEIAAEQGIKLTFLPYVVKALVSALKKYPALNTSFNEEAGEIVHKHYWNIGI
AADTDRGLLVPVVKNADRKSIFQISDEINELAVKARDGKLTSEEMKGATCTISNIGSAGG
QWFTPVINHPEVAILGIGRIAQKPIVKDGEIVAAPVLALSLSFDHRQIDGATGQNAMNHI
KRLLNNPELLLMEG
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttagattacccgacattggtgaaggtatccacgaaggtgaaattgta
aagtggtttgttaaagccggagacactattgaagaagatgatgtgttagctgaagttcaa
aacgataaatccgtagttgaaatcccttctccagtaagcggtacaattgaagaagtggta
gtagacgaaggaactgttgcagtagtaggagacgtcatcgttaaaattgatgcacctgat
gctgaagaaatgcaatttaaaggtcatgatgacgattcatcagctaaagaagagccagct
aaagaagaagctaaagctgaaactgaagaagcgccagcagcatcagcttcacaagatgaa
gaagtagacgaaaatagaaaaattaaagcaatgccttcagttcgtaaatatgcacgtgaa
aaaggtgttaatattaaagcggttgctggttcaggtaaaaatggccgtatcacaaaagaa
gacattgacaaccacttaaatggtggcggtgctcaagctgcatctgcttctaatgaaagt
gcagctgcttcaacttctgaagagacttctgcgcctcaaactcaatcggttccagaaggc
gacttccctgaaacaactgaaaaaatccctgcaatgcgtagagcaattgctaaagcaatg
gttaactctaaacacactgcacctcacgtaacattaatggatgaaattgatgttcaagac
ttatgggatcaccgtaaaaaattcaaagaaattgcagctgaacaaggtattaaattaaca
ttcttaccatatgtagttaaagcacttgtttctgcacttaaaaaatatccagcacttaat
acttcattcaatgaagaagctggcgaaattgttcacaaacattattggaatattggtatc
gcagctgacactgacagaggtttattagtgccagtagttaaaaatgcagatcgtaaatct
atcttccaaatttcagatgaaattaacgaattagctgttaaagctcgcgacggtaaatta
acttctgaagaaatgaaaggtgctacatgtactatcagtaatatcggttctgctggtgga
caatggttcactccagttatcaatcacccagaagtagctatcttaggtattggccgtatt
gcacaaaaaccaatcgttaaagacggcgaaatcgttgcagctcctgtattagcattatca
ttaagctttgaccacagacaaattgatggtgcaactggacaaaatgcaatgaaccatatt
aaacgattattaaataatccagaattattattaatggaggggtaa

DBGET integrated database retrieval system