KEGG   Sulfurovum lithotrophicum: YH65_05940Help
Entry
YH65_05940        CDS       T03877                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
slh  Sulfurovum lithotrophicum
Pathway
slh00010  Glycolysis / Gluconeogenesis
slh00260  Glycine, serine and threonine metabolism
slh00680  Methane metabolism
slh01100  Metabolic pathways
slh01110  Biosynthesis of secondary metabolites
slh01120  Microbial metabolism in diverse environments
slh01130  Biosynthesis of antibiotics
slh01200  Carbon metabolism
slh01230  Biosynthesis of amino acids
Module
slh_M00002  Glycolysis, core module involving three-carbon compounds
slh_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:slh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YH65_05940 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    YH65_05940 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YH65_05940 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:slh04131]
    YH65_05940 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:slh04147]
    YH65_05940 (gpmA)
Enzymes [BR:slh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     YH65_05940 (gpmA)
Membrane trafficking [BR:slh04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    YH65_05940 (gpmA)
Exosome [BR:slh04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   YH65_05940 (gpmA)
  Exosomal proteins of melanoma cells
   YH65_05940 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 TOBE
Motif
Other DBs
NCBI-ProteinID: AKF24982
UniProt: A0A0F6WNC2
LinkDB All DBs
Position
complement(1211540..1212232)
Genome map
AA seq 230 aa AA seqDB search
MAATLILLRHGQSVYNKENIFTGWTDIELSDQGRQEAIKAAAELKRLKLYPDVCYTSWLK
RAIHTAQIALLEMVWEHIDCIKSWKLNERHYGAWQQRNKDVVKQEIGEEAFLSVRRGYST
PPPPLDENDPRAAKFDPKYRDLDPALLPKSESLKDTHARVKEYYRDVLIPELAKGKTVLV
SAHGNSLRALVMEIEHLSTDAVVKLEIPTGKPLVYRYDTGMTAIKKVKVN
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaacattgatacttttacgacacggccaaagtgtctacaataaagagaatatc
ttcacgggatggacagatatcgaactgagcgatcagggacggcaggaggcaataaaagcg
gcagcggaactgaaaagactgaagctctatcccgatgtctgttatacttcatggcttaaa
cgtgcgatccatacggcacagattgcattgttggagatggtatgggaacatatagactgt
atcaagagttggaagctcaatgaacgccactacggcgcctggcagcaacgtaacaaagat
gttgtaaaacaggaaataggggaggaagccttcttgagcgtcaggagaggctacagcaca
ccgccgcccccactggatgagaacgatccccgcgccgcgaagttcgaccccaaatacaga
gatctcgacccggcactgctgcccaaaagcgaatcactgaaagacacccacgcgagagtg
aaagaatattatcgcgacgtgctcatacccgagttggcgaagggaaaaacagtccttgtc
agcgcgcacggaaattcactgcgtgccctggtcatggagatagagcacttaagtaccgat
gccgtcgttaaactcgagatcccgacagggaaaccgctggtctaccgttatgacacaggg
atgactgccatcaaaaaagtgaaagttaattga

DBGET integrated database retrieval system