KEGG   Spirosoma linguale: Slin_0347Help
Entry
Slin_0347         CDS       T01156                                 

Definition
(GenBank) alpha amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
sli  Spirosoma linguale
Pathway
sli00500  Starch and sucrose metabolism
sli01100  Metabolic pathways
sli01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Slin_0347
Enzymes [BR:sli01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Slin_0347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF3459 hDGE_amylase
Motif
Other DBs
NCBI-GeneID: 8724075
NCBI-ProteinID: ADB36411
UniProt: D2QDI1
LinkDB All DBs
Position
complement(441008..442576)
Genome map
AA seq 522 aa AA seqDB search
MHADRTKETKTQASTQSGHLPVNQTRTGVSGVHYEIFVRSFADSNGDGIGDLNGITGKLD
YLKDLGVSAIWLMPISPSPTYHKYDVTDYYGIEPEYGTLDDFKRLITEAHKRGIAVIIDL
VLHHTSIRHPWFQEAAKGPDNPYWNYYKWLRPDEIKRRRLATRDITADSGEKNPWHSVAG
ATYPEKYYGMFWSGMPDLNFDYRPLREEVFAIARYWLNEIGVDGFRLDAARHLYREAEEP
KNHEFWQEFGRVVEAAKPGAYTVGEVWTRPEHIAPYFRGLKANFNFDLQLMIAEIVGQEN
DTEDLVEYLTYVHNTFATVNPEFIDALLLSNHDQNRIGSLLKGNLTHLKVAANLLLTLPG
LPYLYYGEEIGMLGMKPDETIREPFLWDVRANDTQRTRWRRGKYSTSQTVRPLAQQQSDP
DSLFNHYKRLIHYRNSHPVLNDNLSRLVTTGIRQKGIIAFSRQRPSGGPCVLIIHNLTKK
PIEVVFSPSEDWCRCVVFETIPGSSFVGDRVTVPGYGCVIVE
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgcacgctgatcgtactaaagaaacaaaaacgcaggccagcacacagtctggccatcta
cctgtcaatcaaacccgtacgggcgtttcgggggtccattacgaaatctttgttcgctcc
tttgccgactccaacggcgacggcatcggcgatctgaacggtattaccggcaaacttgat
tacctgaaagacctgggtgtttcggccatctggctgatgcccatcagtccatcgccaacg
taccataaatacgacgttaccgactattacggcatcgaacctgaatatggtacgcttgac
gatttcaaacgacttatcaccgaagcccacaagcgcggcattgcggttataattgacctc
gttctacaccataccagtatccggcatccgtggtttcaggaagccgccaaaggccccgat
aacccatactggaattactacaaatggctgcgccccgacgagattaaacggcgtagacta
gccacacgagacattacagccgattcgggcgagaaaaacccatggcattcggtagcggga
gctacttatccggagaaatactacgggatgttctggagcggtatgcccgacctcaacttc
gactatcggccccttcgggaagaggtgtttgccattgcccggtactggctcaacgagatt
ggagtcgatgggttccggctcgatgctgcccggcatttgtaccgggaagctgaagaaccc
aaaaaccatgagttctggcaggagttcgggcgggttgtggaagccgccaaacccggcgcg
tataccgtcggcgaggtctggacacgaccggaacatattgccccgtatttccggggactg
aaagccaacttcaacttcgacctgcaactgatgattgccgaaatcgtcgggcaggagaat
gatactgaagacctggtcgaatacctgacgtatgtacataatacattcgcaacggtcaac
cccgagtttattgatgcgttgctgctgtcgaaccacgatcagaaccgcattggcagttta
ctcaaaggcaacctgacgcatctgaaagtagccgctaacctgttactcacgcttccgggc
ctcccctatctttattacggtgaagaaattggtatgcttggtatgaaacccgacgaaacc
atccgtgaaccctttttgtgggacgtccgagccaacgatacccagcgcacccgctggcgc
cggggaaagtacagtaccagccaaacagtgcggccactggcccaacagcaaagcgatccc
gattccctgttcaatcattacaagcgcctgattcactaccgaaacagtcaccctgttctg
aatgacaacctaagtcggttagtaactacgggcattcgccagaagggcatcattgccttt
agtcggcagcgaccgagtggcggcccctgtgttttaattatccacaacctgaccaaaaaa
ccgatcgaggtcgtcttctcgcccagtgaggactggtgtcgctgtgtggtttttgaaacg
attcccggtagctcattcgtcggcgaccgcgtaaccgttccgggttatgggtgtgtgatc
gtagagtaa

DBGET integrated database retrieval system