KEGG   Spirosoma linguale: Slin_4346Help
Entry
Slin_4346         CDS       T01156                                 

Definition
(GenBank) catalase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
sli  Spirosoma linguale
Pathway
sli00380  Tryptophan metabolism
sli00630  Glyoxylate and dicarboxylate metabolism
sli01110  Biosynthesis of secondary metabolites
sli01130  Biosynthesis of antibiotics
sli01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sli00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Slin_4346
  Amino acid metabolism
   00380 Tryptophan metabolism
    Slin_4346
Enzymes [BR:sli01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     Slin_4346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel DJ-1_PfpI
Motif
Other DBs
NCBI-GeneID: 8728106
NCBI-ProteinID: ADB40328
UniProt: D2QLN8
LinkDB All DBs
Position
5268012..5270162
Genome map
AA seq 716 aa AA seqDB search
MSTEQNKTNTNAKLDELDMNREDSSGQFLTTNQGLRVNDDQNSLKAGPRGATLLEDFILR
EKITHFDHERIPERIVHARGAAAHGYFQAYEPQPELTKAKFLLDPSVQTPVFVRFSTVAG
SRGSTDLARDVRGFAVKFYTEEGNFDLVGNNIPVFFIQDAIKFPDLIHAVKPEPNNEIPQ
AASAHDTFWDFISLTPESMHMVMWVMSDRAIPRSYRMMEGFGVHTFRLINANGKSRFVKF
HWKPLLGVHSVVWDEAQLISGRDPDFHRRDLWDAIEGGAYPEWELGVQVVEEEDEHKFDF
DLLDSTKLIPEELVPIVRLGKMTLNRNPDNYFAETEQVAFHLGHVVPGIDFSNDPLLQGR
LFSYTDTQLKRLGGPNFHEIPINRPIAPVHNGQRDGHMRQTINVGRTSYGPNAINGDSPA
QATEAEGGFVSHAERIDANKVRARSKSFMDHYNQAKLFWNSQSPTEKTHIVKALRFELGK
VVVEDIRKRMLIHLSQIDTTLATLVGEGLGLEVPSAEGVQLNKSVPADANPADYQSEPAK
STVGSSAALSMAHPPKKGIKTRQVAILAADGVDATQLKSMMNALSAEKAIIGIVAPRVGM
LKTSGGETIKIDASLQTTASVLFDAVYVPGGQSSVKSLLQEPDAIRFIHEAFMHCKALAA
TGEGADLLQAAANGGAESLLSSEGVITSSDTGSEVPQKFIDAIEQHRFWSREKKLV
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgagtacggagcaaaacaaaaccaacacgaatgcaaaattagacgagctggacatgaac
cgggaggatagttctggacagtttctgacaaccaatcagggtttacgcgtcaacgatgac
caaaactcgctcaaagccggtccccgtggagccaccttgctggaagactttatccttcgc
gaaaagattacccatttcgaccatgagcggattccggaacgcatcgtccacgcacgtggc
gcggctgctcacgggtatttccaagcctacgaaccccagcccgaactcaccaaagcgaag
tttctgttggacccttccgttcaaacacccgtttttgtccgtttctctaccgtagccggt
tcgcgggggtcgaccgaccttgcccgcgacgtacgtggttttgctgtaaaattctacacg
gaagaaggtaacttcgacctggttgggaataacatacccgtgttctttattcaggatgcc
atcaagtttccggacttgattcatgccgtgaagccggagcctaataacgaaattccacag
gccgcatcggcgcacgataccttctgggactttatctcgcttacgcccgaatccatgcac
atggtgatgtgggttatgtcggaccgggccattccccgtagctaccgtatgatggagggc
tttggcgtacatacgtttaggctcatcaacgccaacggtaagtcgcgttttgtcaagttt
cactggaaaccccttctgggcgttcactccgttgtgtgggacgaagcacagctgatctcc
ggtcgtgaccctgattttcaccgtcgcgatctatgggatgccatcgaagggggcgcttac
ccggaatgggaattgggtgttcaggtcgtggaagaagaagacgagcataaattcgatttc
gacttactggattcaaccaaactcattcccgaagagctggtgcccattgttcggcttggt
aagatgacactcaaccgaaacccggacaactatttcgccgaaaccgagcaggtcgctttc
cacctggggcacgttgttcccggcatcgacttctccaacgacccgttgttgcagggacgt
ctcttttcctatacggatacgcagttgaaacggctgggtggaccaaacttccacgagatc
cccattaaccggcccattgctccggtacataacggccagcgcgatggccatatgcgccag
acaatcaacgttggacgtacgagttatggccccaatgccatcaacggtgattcgcccgcg
caggccacggaggcagaaggcggctttgtgagccatgccgaacgaattgatgcaaacaag
gtccgcgcccgcagcaagagcttcatggaccattataaccaggccaaattgttctggaat
agccagtcgccaacggagaagacccacatcgttaaagccctgcgttttgagttaggcaaa
gtggtcgttgaagacatccggaagcggatgcttattcacctgtcgcagattgatacaacc
ctggcaacgcttgttggcgaaggactgggactggaggttccatcggctgagggcgtacaa
ttgaacaagagcgttccggcagatgctaaccccgctgactaccaatcggaacccgccaaa
tcgaccgtgggcagctcggcagcattgagcatggcgcatccgcccaaaaaaggcattaaa
acgcgtcaggtggcgattctggctgccgatggcgtcgatgctacgcagctaaaatccatg
atgaacgccctgtcggccgagaaagcgattatcggaattgttgccccacgggtagggatg
ctgaaaacatcgggtggtgaaacgataaagatcgatgccagcctgcaaacgacggcgtcg
gttctgtttgacgcggtgtatgtaccgggtggacaaagcagtgtgaaatccctacttcag
gagcccgatgccattcggtttattcacgaagcgttcatgcactgcaaagctctggccgct
accggcgaaggtgccgacttgctacaggcagctgccaacggtggtgccgaatctctgctg
agcagcgaaggggttatcaccagttctgatacgggcagtgaggttccccagaaattcatc
gacgccattgagcagcaccgcttctggagccgggaaaaaaagctggtatag

DBGET integrated database retrieval system