KEGG   Spirosoma linguale: Slin_5162Help
Entry
Slin_5162         CDS       T01156                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
sli  Spirosoma linguale
Pathway
sli00240  Pyrimidine metabolism
sli01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sli00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Slin_5162
Enzymes [BR:sli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Slin_5162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-GeneID: 8728928
NCBI-ProteinID: ADB41134
UniProt: D2QGW2
LinkDB All DBs
Position
6302336..6302965
Genome map
AA seq 209 aa AA seqDB search
MFIEPSRRREPPHLRTGWIEVICGSMFSGKTEELIRRLTRAQIAKLNVKIVKPALDTRYH
DENIVSHSSITISSVPVQTAGQILALAGNCDVVGIDEAQFFDQDITNVCTQLANQGKRVI
VAGLDMDFAGKPFGCMPQLLSIAEYVTKVHAICVVCGDIAQYSYRLVPSKERVLLGETDS
YEARCRRCFNLGNDAGRKEWAYEDIANDE
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgtttattgaaccctctcgtcggcgcgaaccaccccaccttcgtaccggatggatagaa
gtgatatgtggctcgatgttctctgggaaaacggaagaattaattcgcaggctcacccgc
gcccagatagcgaaactgaatgtcaaaatcgttaaacccgctctcgacactcggtatcat
gatgaaaatatcgtctcgcattcgtcgatcacgatttcctctgttcccgtgcaaacagcg
ggccagattttagcgttagccgggaattgtgacgtagttggtattgatgaagcccaattt
tttgatcaggacatcacaaatgtgtgtacacagttggccaatcagggaaagcgggttatc
gttgccgggctggatatggattttgccggtaagccattcgggtgtatgcctcaattgctc
agcattgctgaatacgttacgaaagtccatgccatttgcgtagtctgtggcgacatagcc
caatactcataccggctggtgccctccaaagagcgtgtgttgctgggcgaaacagacagt
tacgaagcccgatgccgacgatgttttaaccttggcaatgatgcgggccggaaagagtgg
gcttacgaagatatagcgaatgatgaatga

DBGET integrated database retrieval system