KEGG   Spirosoma linguale: Slin_5892Help
Entry
Slin_5892         CDS       T01156                                 

Definition
(GenBank) enoyl-ACP reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
sli  Spirosoma linguale
Pathway
sli00061  Fatty acid biosynthesis
sli00780  Biotin metabolism
sli01100  Metabolic pathways
sli01130  Biosynthesis of antibiotics
sli01212  Fatty acid metabolism
Module
sli_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:sli00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Slin_5892
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Slin_5892
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Slin_5892
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sli01004]
    Slin_5892
Enzymes [BR:sli01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Slin_5892
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     Slin_5892
Lipid biosynthesis proteins [BR:sli01004]
 Fatty acid synthase
  Component type
   Slin_5892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-GeneID: 8729670
NCBI-ProteinID: ADB41855
UniProt: D2QSS3
LinkDB All DBs
Position
7134702..7135517
Genome map
AA seq 271 aa AA seqDB search
MAYGLLNGKRGIISGALDEKSIAWKVALKAKEEGATFTLTNAPIAMRMGAIKQLAEQCNA
EIIPADATSVEDLENLFTKSTEVLGGKVDFVLHSIGMSPNIRKGKAYTDLNYDWFKQSID
ISALSFHKMMQTAYKLDAISEWGSVVALTYMAAQRTFPFYTDMADAKAVLESIARSFGYR
YGKSHKVRVNTISQSPTPTTAGGGIGGFDKFYDFADKTAPLGNATADQCADYCITLFSDL
TRMVTMQNLFHDGGFSMTGISEEVMALVTKE
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggcttacggattactgaacggaaaacgcggcatcatttccggtgccctggacgaaaaa
tcaatcgcctggaaggtcgctttgaaagcgaaggaagaaggtgctacgtttaccctcacc
aacgcgcccattgcgatgcgtatgggagcaatcaaacaactcgctgagcagtgcaatgcc
gaaattattccggctgacgcgacgtcggtcgaagacctggaaaatctgttcaccaaatca
accgaagtgctgggcggtaaagttgactttgtgctgcacagcattggcatgagccccaac
atccgtaagggtaaagcctatacagacctgaattacgactggttcaaacaaagcatcgac
atctcggccctgtcgttccacaaaatgatgcagacggcctataaattggacgctatcagc
gaatggggttcggtggtagccctaacctacatggcagctcagcggacgtttccgttctac
acggatatggccgatgcaaaagcggtactggagtcgattgcccgcagctttggctaccgc
tatggtaagtcgcataaggtgcgtgtgaatacaatttcgcaatcgccaacgccaacgacg
gcgggtggcggtatcggtggcttcgataagttctatgacttcgccgacaaaaccgcgccc
ctgggcaatgccaccgctgaccagtgcgcggactactgcatcacgctcttctcggacttg
acccgcatggtgaccatgcagaacctgttccacgatggcggtttctccatgactggtatc
tcggaagaagttatggcgttggtaacgaaagagtaa

DBGET integrated database retrieval system