KEGG   Spirosoma linguale: Slin_6209Help
Entry
Slin_6209         CDS       T01156                                 

Definition
(GenBank) malto-oligosyltrehalose trehalohydrolase
  KO
K01236  maltooligosyltrehalose trehalohydrolase [EC:3.2.1.141]
Organism
sli  Spirosoma linguale
Pathway
sli00500  Starch and sucrose metabolism
sli01100  Metabolic pathways
sli01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Slin_6209
Enzymes [BR:sli01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.141  4-alpha-D-{(1->4)-alpha-D-glucano}trehalose trehalohydrolase
     Slin_6209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF3459 CBM_48 Malt_amylase_C GHL6
Motif
Other DBs
NCBI-GeneID: 8729992
NCBI-ProteinID: ADB42168
UniProt: D2QTN6
LinkDB All DBs
Position
7522933..7524798
Genome map
AA seq 621 aa AA seqDB search
MNQALLNHRMLGVTFGPDGATARVWAPFAQNVVLRRCNRPLDIPLQQDGAYWCITTAQLQ
PGDSYTFILNDNIERPDPASLFQPEGVHGPSGVVDTRTFVWTDADWPNFPLDDYLIYELH
TGTFSPEGTFAGIENRLDYLVELGINAIEIMPVAQFPGSRNWGYDGVLPYAVQNSYGGAE
GLQKLVDACHKRGLAVVLDVVYNHIGPEGNYLEDFGPYFTAKHLTPWGNAINFDDDYSDS
VRRYFIENVLMWFRDFHIDALRLDAVHAICDASETHILREIKQYVDALMVKTGRQHYLIV
ELDQNETQFIQPLVNNGYGMDAQWNDEFHHALRVTAGGERNGYYADYDGIHHLAKSYTDA
YVYDGTYMPRRARIVGKSTAGHAGRQFVVFSQNHDQIGNRMLGERPSQLVSLEMQKLMAG
AVMSSPYLPMLFMGEEWGELNPFLYFVSHSDPSLVEAVRQGRKKEFADFQTDFETPDPQD
KRTFEQSKLQWGRLTQEPHRTLFRYYQTLLALRKSSSLRHPDRESVAVVVDEIRQTLTLF
RQHKKQEGTSPADTSETVVCLMNFSKDGQSLTLPANESQWRKLLDSADPQWHGPMAAPVH
VAGSAAVVLQPESILIYTNCE
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaggcattactcaaccaccgaatgctgggggtcacgttcgggcccgatggggcc
accgcccgcgtttgggcaccctttgcccagaacgtcgtacttcggcggtgtaaccgcccg
ctcgatattccgcttcaacaggatggtgcttactggtgcatcacaacggcccagttgcaa
cccggcgatagctacacgtttattctcaacgataacatcgaacgacccgatccggcgtcg
ctattccagccggagggcgtgcatgggccgtcgggcgtggtagatacccgaacgtttgtc
tggacggatgcggactggccaaattttccgctggacgattacctgatttatgagcttcac
accggcacgttctcgcccgaagggactttcgcgggcatcgaaaaccggcttgattatctg
gttgaactgggtatcaacgccattgagattatgcccgtggcacagttccccggctcccga
aactgggggtacgatggcgtgctgccctatgccgtacaaaattcttacggcggtgccgag
ggcttgcagaaactggtcgatgcctgccataagcgtgggctggccgtggtgctcgatgtc
gtgtataaccacatcggacccgaaggcaactacctcgaagattttggtccatactttact
gccaaacacctcacgccctggggaaacgccattaatttcgacgatgattacagcgatagc
gtccggcggtacttcattgaaaacgtgctgatgtggttccgcgattttcacatcgacgcc
ctgcgactcgatgccgttcatgccatctgcgatgccagcgaaacgcatatcctgcgcgaa
ataaaacagtatgtcgatgctctgatggtaaaaaccggtcggcagcattacctgatcgta
gaactggatcagaacgaaacgcagttcattcagccgctggtcaacaatggctacggcatg
gacgcccagtggaacgacgaatttcaccatgcgctgcgtgtaacggcgggtggcgaacgc
aacggctactacgccgattacgacggcattcatcacctggccaaatcctatactgatgcc
tatgtgtatgatggtacctacatgccccgacgcgcccggattgttggcaagtcgacggcg
ggccatgccgggcggcagtttgtagtgttctcgcaaaaccacgatcagattggcaaccga
atgctgggcgagcgacccagccaactggttagtctggagatgcagaagctcatggccggg
gccgttatgagcagtccctatctgcccatgctattcatgggtgaagaatggggcgaacta
aatccctttctgtatttcgtgagtcattcggaccccagtctggtggaagccgttcggcag
gggcgcaagaaagaatttgccgattttcaaacggatttcgaaacgccggacccgcaggat
aagcgtacgttcgagcagtctaaactccagtgggggcggctcacgcaggaaccgcaccgg
accctctttcggtattaccaaacgctgctggccctacggaagtcgtcgtcgttacgacac
ccggatcgggagtcggtggccgttgttgtggacgaaattcgccagacacttacccttttt
cgacagcataagaagcaggagggaaccagcccggcggatacatccgagaccgtagtttgt
ctgatgaacttctccaaagatggtcaatcactcaccttaccggccaatgaaagccagtgg
cgcaagttactcgactccgccgatccacaatggcacggcccaatggcggctccggtacat
gtagcgggcagtgcggccgttgttctccagcctgagtctatactgatttatacaaattgc
gagtag

DBGET integrated database retrieval system