KEGG   Sulfuricaulis limicola: SCL_0215Help
Entry
SCL_0215          CDS       T05241                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
slim  Sulfuricaulis limicola
Pathway
slim00970  Aminoacyl-tRNA biosynthesis
slim01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slim00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SCL_0215
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:slim03029]
    SCL_0215
Enzymes [BR:slim01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     SCL_0215
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     SCL_0215
Mitochondrial biogenesis [BR:slim03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SCL_0215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: BAV32537
UniProt: A0A1B4XCI1
LinkDB All DBs
Position
215880..217313
Genome map
AA seq 477 aa AA seqDB search
MEWETVIGLEVHAQLMTKSKAFSGAATKYGAEPNTQACAVDIALPGVLPVFNKEAARMAV
KFGLAIGAAINHRSVFARKNYFYPDLPKGYQISQYELPVVAKGQITIDVDGVEKVVGITR
AHLEEDAGKSLHEDFHGMTGIDLNRAGTPLLEIVSEPDMRSPKEAVAYLKKLHELVRYLE
ICDGNMQEGSFRCDANVSVRPKGETKFGTRAELKNINSFRFVEKAIEFEVERQIELIEGG
GKVVQETRLYDSDKDVTRSMRSKEEAMDYRYFPDPDLPPLVLDQAFIDAVKTTLPELPNA
KRVRFMKDYGLNAYDAGVLTSSRELADYYEQVVRESKADSKIAANWVTGELAAFLNRDNK
EITASPVTVAMMSGLLKRLADNTISGKIAKEVFEAMWNGEGDADAVIEKKGLKQITDTGA
IEKVIDEVIAKNPKQLEQYRAGKEALFGYFVGQVMKASQGKANPAQVNELLKKKLSS
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggaatgggaaaccgtcatcggtcttgaagtccacgcccagctcatgacaaagagcaag
gcgttctcgggcgcagccacgaaatacggcgccgagccgaacacccaggcctgcgcggtg
gatattgccctgccgggcgtgctcccggtgtttaataaagaagccgcgcgcatggcagtg
aagtttggactcgccatcggcgcggccatcaatcaccgctcggtgttcgcgcgcaagaat
tatttctaccccgacctgcccaagggctaccagatcagccagtacgaactgccggtcgtg
gccaagggccagatcaccatcgacgtcgatggcgtggaaaaggtcgtcggcattacccgc
gcgcatctggaagaagacgccggcaagtcgctgcacgaggatttccacggcatgaccggc
atcgacctcaaccgcgccggcacgccgctgctcgagatcgtctccgagccggacatgcgt
tcgcccaaggaggccgtggcctacctgaaaaagctgcacgagctggtgcgttatctcgaa
atctgcgacggcaacatgcaggaaggctcgttccgttgcgacgccaacgtctcggtgcgc
ccgaaaggcgaaaccaaattcggcacccgcgccgagctcaagaacatcaattccttccgc
ttcgtcgagaaggccattgaattcgaggtcgagcgccagatcgagctgattgaaggtggc
gggaaagtggtgcaggagacgcgcctgtacgactccgacaaggacgtcacgcgttccatg
cgcagcaaggaagaggccatggattaccgctacttccccgatcccgacctgccgcccctg
gtactggaccaggccttcatcgatgccgtcaaaaccaccctgcctgaattgccgaacgcc
aagcgtgtgcggttcatgaaggattacgggctcaatgcctatgacgccggcgtattaacc
tcctctcgcgaactggccgattactacgagcaggtggtgcgcgaatcgaaggccgattcc
aagatcgccgccaactgggtcacgggcgaactggcagcgttcctcaaccgcgacaacaag
gaaattaccgcgtcaccggtgacggtggcgatgatgtcaggcttgctcaaacgcctcgcc
gacaacaccatctccggcaagatcgcgaaagaagttttcgaggccatgtggaacggcgag
ggcgatgccgacgccgtgatcgaaaagaagggcctgaaacagatcaccgacaccggcgcg
atcgagaaagtcattgacgaagtgatcgcgaaaaacccgaagcagctcgagcagtaccgc
gccggcaaggaagcgctgttcggctatttcgtcggccaggtgatgaaggcctcgcagggc
aaggccaatccggcgcaggtcaacgaactgctgaagaaaaaattatcttcatag

DBGET integrated database retrieval system