KEGG   Sulfuricaulis limicola: SCL_0554Help
Entry
SCL_0554          CDS       T05241                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
slim  Sulfuricaulis limicola
Pathway
slim00473  D-Alanine metabolism
slim00550  Peptidoglycan biosynthesis
slim01100  Metabolic pathways
slim01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:slim00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SCL_0554
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SCL_0554
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SCL_0554
Enzymes [BR:slim01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SCL_0554
Peptidoglycan biosynthesis and degradation proteins [BR:slim01011]
 Precursor biosynthesis
  Amino acid ligase
   SCL_0554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 ATPgrasp_Ter ATPgrasp_ST RimK GARS_A ATPgrasp_YheCD TTL
Motif
Other DBs
NCBI-ProteinID: BAV32876
UniProt: A0A1B4XDJ8
LinkDB All DBs
Position
542514..543431
Genome map
AA seq 305 aa AA seqDB search
MSRNFGKVAVLMGGPSAEREVSLKSGNAVLAALKRKGVDAHGFDADKSTLRQLEDGKFER
VFIVLHGRWGEDGVIQGALEVLDIPYTGSGVLGSALGMDKLRTKYLWSAAGIPTPEYAVL
EAGTDFDKVAAKLGLPVFVKPVREGSSLGVSKARTVAELKAAWKSAAKYDDQVIAERFID
GAEITCGILGDQALPLIRIETDREFYDYEAKYILDTTRYLCPCGLPADQERAIQALAQRA
FAALGCSGWGRVDFMLDKDGRAYALEVNTVPGMTDHSLVPKAAQQAGMNFDELVLKILET
ADVER
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaaatttcggcaaggtggcggtattgatgggcggcccttccgccgagcgcgag
gtgtcgctcaagagcggcaatgccgtgctcgcggccctgaagcgcaagggggtcgatgcg
catggcttcgacgccgataaatccaccctgcgccagctggaagacgggaaattcgaacgc
gtgttcatcgtgctgcacggacgctggggcgaggacggcgtgatccagggcgcgctcgaa
gtgctcgacattccctataccggcagcggcgtgctcggctcggcgctcggcatggacaag
ctcagaaccaaatatctctggtccgccgccggcattccgacgccggaatacgccgtgctg
gaagccgggaccgatttcgacaaggtcgctgcaaaacttggtctgccggtgttcgtgaaa
ccggtgcgtgaaggatcgagcctcggcgtgagcaaggccaggacggtggccgaactgaag
gcggcctggaagagcgcggccaaatacgacgatcaggtcatcgccgagcgcttcatcgac
ggcgccgagatcacctgcgggattctcggcgatcaggccttgccgctgatcaggatcgag
accgatcgggaattctacgactacgaagcgaagtacatcctcgataccacgcgctatctc
tgcccctgcggcctgcccgcggaccaggagcgcgccatccaggcgctggcgcaacgcgca
ttcgccgcgctcggttgcagcggctggggccgggtggatttcatgctcgacaaggacggg
cgcgcgtacgcgctcgaggtcaacacggtaccgggcatgacggatcacagcctggtgccc
aaggcggcgcagcaggcgggcatgaatttcgatgaactggttttgaaaatactggagacg
gcggatgtcgagcgctga

DBGET integrated database retrieval system