KEGG   Sulfuricaulis limicola: SCL_2424Help
Entry
SCL_2424          CDS       T05241                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small chain
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
slim  Sulfuricaulis limicola
Pathway
slim00630  Glyoxylate and dicarboxylate metabolism
slim01100  Metabolic pathways
slim01120  Microbial metabolism in diverse environments
slim01200  Carbon metabolism
Module
slim_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:slim00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SCL_2424
Enzymes [BR:slim01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     SCL_2424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: BAV34701
UniProt: A0A1B4XIT1
LinkDB All DBs
Position
complement(2465252..2465608)
Genome map
AA seq 118 aa AA seqDB search
MSEMQDYKSSLTDTSSRKFETFSYLPAMTSDGIKKQVEYLVRQGLNPAIEHTEPENAFDH
YWYMWKLPMFGETNVDKVLAEAEACHKAHPNNHVRLIGYDNFKQSQGASMVIFRGKMK
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaatgcaagattacaaatccagcctgaccgacaccagcagccgcaagttcgag
accttctcctacttgccggccatgaccagcgacggcatcaagaaacaggtggagtatctg
gtgcggcagggcctgaacccggcgatcgaacacaccgagccggagaatgccttcgaccac
tactggtatatgtggaagctgccgatgttcggcgaaaccaacgtggacaaggtgctggcc
gaggccgaggcgtgtcacaaggcgcacccgaacaaccatgtgcggctgattggctacgac
aacttcaaacagtcgcagggcgcctcgatggtgattttccgcggcaagatgaagtaa

DBGET integrated database retrieval system