KEGG   Sulfuricaulis limicola: SCL_2519Help
Entry
SCL_2519          CDS       T05241                                 

Definition
(GenBank) hypothetical protein
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
slim  Sulfuricaulis limicola
Brite
KEGG Orthology (KO) [BR:slim00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:slim01001]
    SCL_2519
Enzymes [BR:slim01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SCL_2519
Protein kinases [BR:slim01001]
 Serine/threonine kinases: Other
  Bacterial family
   SCL_2519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Sel1 FTA2 Kinase-like Kdo APH Pkinase_fungal RskA Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: BAV34796
UniProt: A0A1B4XJ10
LinkDB All DBs
Position
complement(2564514..2565869)
Genome map
AA seq 451 aa AA seqDB search
MTPGAAQNIAETLAARYEVMEALGDGGMGMVYRVRDRETNEILALKLLRPEIARDPAMME
RFKNEIRLAHRITHKNVCRIYDFNRVDDLAYFTMEHVDGESLRAWLKRAGKLTPERTIDL
ARQITAGLGEAHARGVVHRDLKPENVMLGRDGLVKLLDFGIARALDSDTATARTIMGTPE
YMAPEQSQGKAVDQRVDLYALGLILYECLTGRRAFSGATPVEIALKQLKEKPQPPRKFLP
TTPPHLEAVVLRCLEKDPARRFASAAELQRALVQPGAPPRQGPRLRKTAVFATIGLLAVL
AAYKLVNRQDTSSASVQARDATTSLPDQQQVPEELVKLFEAAKQGDAVAQERVGRLYLDG
PARARDERKAFFWTRQAALSGDGNAQFTLAQMYESGRGAPHNLVGAFVWYNVALSSGNES
ARVPFERLKEKISSDELAEAEQQLHRLRRGR
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcccggcgctgcgcagaacatcgccgagacactggcggcgcgttacgaggtcatg
gaggcgctgggcgacggtggcatgggcatggtgtaccgcgtgcgtgaccgcgaaaccaat
gagatcctggcgctcaagctgctgcggccggagattgcgcgcgacccggccatgatggag
cgcttcaagaacgaaatccgcctggcgcatcgcatcacgcacaagaacgtctgccgcatt
tacgatttcaatcgcgtcgatgatctggcgtatttcacgatggagcatgtggatggcgag
agtctgcgcgcctggctcaagcgcgcgggcaagctgacgcccgagcgcaccatcgacctg
gcacgccagatcacagccggtctgggcgaggcgcatgcccggggcgtggtgcatcgggac
ttgaaaccggagaacgtcatgctcggccgcgatggcctggtgaagctgctggatttcggc
attgcgcgtgccctggacagtgacaccgccacggcgcgcaccatcatgggcacgcccgaa
tacatggccccggaacaatcgcagggcaaggcggtggatcagcgtgtggacctgtatgcg
ctggggctcattctctacgaatgcctgactggccggcgcgcgttttccggcgccaccccg
gtggaaattgcgctcaagcaactcaaggagaaaccgcagcctccaagaaaatttctcccc
accaccccgccgcatcttgaggccgtggtgctgcgttgtctggaaaaagacccggcacgg
cgatttgccagtgccgctgaacttcagcgcgcactggtgcagcccggcgccccgccgcga
caggggccccgcctgcggaagaccgccgtttttgcgaccatcggattgctggctgttctg
gctgcctacaagctggtgaatcggcaagacacgtcatccgcgtcggttcaggcgcgagac
gccacgaccagcctgccggatcagcaacaggtgccggaagaactggtcaagctgttcgag
gcggcgaagcaaggcgacgccgtggcgcaggaacgcgtcggccggttgtaccttgacggc
cccgcccgcgcccgcgacgagcgcaaggccttcttctggacgcgccaggccgccctcagc
ggcgatggcaacgcgcagttcacactggcgcaaatgtatgagagcggtcgtggcgcgccg
cacaatctcgtcggcgccttcgtctggtacaacgtcgcgctgagttccggcaacgagtcg
gcgcgcgtgccgttcgagcgcctgaaggagaaaatttccagcgacgaattggccgaggcg
gaacagcagttacacaggctgcgaaggggtcggtaa

DBGET integrated database retrieval system