KEGG   Sulfuricaulis limicola: SCL_2736Help
Entry
SCL_2736          CDS       T05241                                 

Definition
(GenBank) glycosyl hydrolase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
slim  Sulfuricaulis limicola
Pathway
slim00500  Starch and sucrose metabolism
slim01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slim00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SCL_2736
Enzymes [BR:slim01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     SCL_2736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15 Prenyltrans TED_complement
Motif
Other DBs
NCBI-ProteinID: BAV35013
UniProt: A0A1B4XJP8
LinkDB All DBs
Position
2776516..2778894
Genome map
AA seq 792 aa AA seqDB search
MDQTTHMSVTEDRAPGAPGIPPTWTSSAKDMVGCALGSSRLWYSVGYGIVNEVYYPRIDI
PQIRDLGFIVADDKGFWVEVKRLHGREVRTAAPGVPAVEIVHRHPRFDLTLRIAPDQQRD
VLLIDVRLDGDEDLRPYTLLAPHLGGTGYDNHAAVNEYHGRKLLWAEQGPFGLALAAVDA
TQRDAWGRASAGYVGMSDGWQDFKHNGAMQWQYREAGPGNVALMGELPRRSTLALGFGSS
RESAATLAVGALMQPFANHWQAQIDRWRDWHAGCDECCKATPDLPAALREQFTTSAMVLR
AHLDLTYPGAMVASLSIPWGNTRNERGGYHLVWPRDLAECAGALLALGDDDKAREILRYL
ISTQHADGHWNQNQWLGGKPFWQGIQLDETAFPVLLAARLHEHDALAGTEVTDMVRRALG
FIARTGPASDQDRWEEDAGVNAFTLAACIAALVGGARFLEPAARDMALALADDWNAQIEK
WTLARGTELARRAGVAGYYVRIAPAETLMDEEALNGSLPIKNRVQDPGLPATEQVGTDFL
QLVRFGLRRADDPLILDTLKVVDELLKVDTPGGPAWHRYNGDGYGEHSDGAPFDGTGQGR
AWPLLTGERGHYELCAGRDPLSLLTTMASMCGPGGMMPEQVWDSAAIPARWLYPGRPTGS
AMPLAWAHAEYIKLAVSRALGTPFDRPAAVWERYHGQAPAATWRHWCEQAPIGRIGAGQR
LRICLHAPSLVRWSADGWRTVYELRTEDSGLGLHTVTPVMTMVSGGARIEFSFRHDDSRV
ADERRYRIEITG
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atggaccaaaccacgcacatgtcggtcaccgaagatcgcgcgccgggcgcgcccggcatc
cccccgacctggacgagcagcgccaaggacatggtcggctgcgcactgggttcgtcgcgg
ctctggtatagcgtcggctacggcatcgtcaacgaagtctattacccgcgcatcgatatt
ccgcagatccgcgatctgggttttatcgtcgccgacgacaagggattctgggtggaggtg
aaacgtctgcacggccgcgaggtgcgcaccgccgcgcccggcgtccctgcggtggaaatt
gtgcatcgccacccgcgtttcgatctcacattgcgcatcgcgccggatcaacaacgcgac
gtgttgctgatcgatgtccggctggacggcgacgaagacctccggccttacaccctgctc
gcgccgcatctcggtggcaccggctacgacaaccacgcggcagtcaatgaatatcacggt
cgcaagctgctgtgggcggaacaggggcccttcggactggcgctggccgccgtggacgcg
acgcagcgcgatgcctggggccgcgccagcgccggctatgtcgggatgagcgacggctgg
caggacttcaagcataacggcgcgatgcagtggcagtaccgggaggccggtcccggcaat
gtcgcgctcatgggtgaactgccgcgccgttcgacgctggcgctcggcttcggcagcagc
cgcgagtcggctgcaactctcgcggttggcgcgctgatgcagccatttgccaaccactgg
caggcgcaaatcgaccgctggcgggactggcatgccggctgcgatgaatgctgcaaggcc
acgcccgatctgccggcagccttgcgcgagcagttcacgacgtcggcgatggtgctgcgc
gcgcatctcgatctgacctaccccggggcgatggtggcgagcctgagtattccctggggc
aatacccgcaacgaacgcggcggttatcacctggtgtggccgcgcgacctggccgaatgc
gcgggcgcgctgctggcgctcggcgacgacgacaaggcgcgcgaaatcctgcgttacctg
atctcgacccagcatgccgatggacactggaaccagaatcagtggctgggcggcaagccg
ttctggcaggggatccagctcgatgagactgcgtttccggtgctgctggccgcgcgcctg
cacgaacacgacgcccttgccggtaccgaggtaacagacatggtgcgccgggcgctcggt
ttcatcgcgcgcaccggaccggccagcgatcaggaccgctgggaggaggacgccggggtg
aatgccttcacgctggcggcgtgcatcgcggcactggtgggcggggcgcgctttctcgaa
ccggctgcgcgcgacatggcgctggcactggccgacgactggaatgcccagattgaaaaa
tggacgctggcgcgtggaaccgaactggcgcgtcgcgccggcgtggcgggttattacgtg
cgtatcgcgccggccgagacgctgatggacgaagaagcgctcaacggatccctgccgatc
aagaatcgtgtgcaggaccccggactgccggccacggagcaggtcggcaccgattttctg
caactggtgcgcttcggcctgcgccgcgccgacgacccgctgatcctcgacacgctcaag
gtggtcgatgaattattgaaagtcgatacgcccggcggtccggcgtggcatcgctataac
ggcgacggctacggcgagcattctgacggcgctccgtttgacggcaccggccagggccgc
gcctggcccctgctcaccggcgagcgcggacattacgagttatgtgccggccgcgatccg
ctgtctctgctgaccaccatggcgtccatgtgcggaccgggcgggatgatgccggaacag
gtttgggacagcgcggcgataccggcgcgctggctctaccccggacgccccaccggttcg
gccatgccgctggcctgggcccacgcggaatacatcaagctggcggtatcgcgcgcgctg
ggaacgccctttgaccggccggccgcggtgtgggaacgctaccacggccaagcgccggcg
gcgacgtggcgacactggtgtgaacaggcaccgatcggtcgcatcggcgcgggtcagcga
ctgcgcatctgcctgcacgcaccgtcactggtacgctggagtgcggacggctggcgtacc
gtatacgagctgcgcaccgaggacagcggactgggtctgcacaccgtgacgccggtcatg
acgatggtatcgggcggcgcgcggatcgagttcagtttccgccatgacgacagccgggtc
gcggacgagcgacgttaccggatcgagatcaccggttga

DBGET integrated database retrieval system