KEGG   Shewanella livingstonensis: EGC82_01180Help
Entry
EGC82_01180       CDS       T05875                                 

Gene name
fadB
Definition
(GenBank) fatty acid oxidation complex subunit alpha FadB
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
slj  Shewanella livingstonensis
Pathway
slj00071  Fatty acid degradation
slj00280  Valine, leucine and isoleucine degradation
slj00281  Geraniol degradation
slj00310  Lysine degradation
slj00362  Benzoate degradation
slj00380  Tryptophan metabolism
slj00410  beta-Alanine metabolism
slj00640  Propanoate metabolism
slj00650  Butanoate metabolism
slj00903  Limonene and pinene degradation
slj00930  Caprolactam degradation
slj01100  Metabolic pathways
slj01110  Biosynthesis of secondary metabolites
slj01120  Microbial metabolism in diverse environments
slj01130  Biosynthesis of antibiotics
slj01200  Carbon metabolism
slj01212  Fatty acid metabolism
Module
slj_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:slj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    EGC82_01180 (fadB)
   00650 Butanoate metabolism
    EGC82_01180 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    EGC82_01180 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EGC82_01180 (fadB)
   00310 Lysine degradation
    EGC82_01180 (fadB)
   00380 Tryptophan metabolism
    EGC82_01180 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EGC82_01180 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    EGC82_01180 (fadB)
   00281 Geraniol degradation
    EGC82_01180 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EGC82_01180 (fadB)
   00930 Caprolactam degradation
    EGC82_01180 (fadB)
Enzymes [BR:slj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     EGC82_01180 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     EGC82_01180 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     EGC82_01180 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     EGC82_01180 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 Tex_N NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: AZG71503
UniProt: A0A3G8LNY5
LinkDB All DBs
Position
complement(264155..266305)
Genome map
AA seq 716 aa AA seqDB search
MIYQSPTIQVELLEDNIAKLCFNAQGSVNKFDRETIASLDAALDSIKQNTDIKALLLTSA
KSTFIVGADITEFLSLFKQDDATLLAWVEQANAVFNKLEDLPFPTASAINGFALGGGCET
ILATDLRVADTNARIGLPETKLGLIPGFGGTVRLPRVIGADNALEWITTAKDQRPEDALK
VGAIDAVVAPENLEAAAIQMLHDALNGSLDWQARRTKKQSPLQLPKLEAMMSFATAKGMV
FSVAGKHYPAPMAAVNVVEQAAGLDRDGALKVEAQAFIKLAKTDVAQALIGIFLNDQFVK
GKAKKAAKLAHNVNQAAVLGAGIMGGGIAYQSASKGTPIVMKDIAQPALELGLNEAAKIL
TTQVARGRSTPEKMAKVLNNITPSLDYAAIKNSDIVVEAVVEHPKVKATVLAEVEGYVSE
DAIIASNTSTISINLLAKSLKKPERFCGMHFFNPVHKMPLVEIIRGEHSSEETIATVVAY
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSGLLAEGADFAAVDKVMEKQFGWPMGPAYL
LDVVGLDTGHHAQAVMAEGFPDRMGKNGKDAIDIMFENKRLGQKNAKGFYAYSVDRRGKP
KKDIDPTSYALLGETFGELKVFESDDIIARCMIPMIIETVRCLEEGIIASPAEGDMGLVY
GIGFPPFRGGVFRYLDTMGVANFVALADKYAHLGGLYQVTDTMRKLAANNGSYYQA
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgatctaccaaagccctaccattcaggttgagttacttgaagataatattgccaaactg
tgttttaacgcacaaggttcggtaaataagtttgacagagaaactatagcctctctagat
gccgccttagacagcatcaaacaaaacactgatattaaagccttattgctgacgtcagca
aaaagtacttttattgttggcgcagacatcactgaatttctaagcctttttaagcaagac
gatgcaactttgttagcttgggttgaacaagctaatgcggtattcaacaaacttgaagat
ttaccgtttccaacggcatcagccatcaacggttttgctcttggtggtggttgtgagacc
attttagcaaccgacttacgtgttgcagataccaatgctcgcatcggtttaccagaaacc
aaattaggtcttattcctggttttggtggcacagtgcgtttaccgcgtgtgatcggtgca
gataatgcacttgagtggatcactaccgctaaagaccaacgtccagaagatgcactaaaa
gtaggcgcgattgatgccgttgtcgcaccagaaaacttagaagctgctgcgattcaaatg
ttgcatgatgcccttaatggtagccttgattggcaagctcgtcgtaccaaaaagcaatca
ccattacagttaccaaaacttgaagccatgatgtcttttgctaccgctaaaggaatggtg
ttttctgttgcaggcaagcattatccagcgccaatggccgctgtgaatgttgtcgaacag
gctgctggtttggaccgtgatggcgcattaaaagtggaagcacaagctttcatcaaatta
gctaaaacagacgttgcccaagcgctaattggtattttcttaaatgaccagttcgttaaa
ggcaaagcaaagaaagctgctaaattagctcataatgtcaaccaagcagcggtattgggt
gcaggtattatgggcggcggtattgcttaccaaagcgccagcaaaggcacaccaattgtg
atgaaagacatcgctcagccagcattagagctaggcttgaacgaagcggctaaaatcctg
acaacacaagttgctcgtggtcgttctacgccagagaaaatggctaaagtattaaacaac
atcacgccttcactagattatgccgctatcaaaaatagcgatatcgttgtagaagcggtt
gttgaacatccaaaagttaaggctactgtactagctgaagttgaaggttacgtatcagaa
gatgccattattgcgtcaaacacctcgactatctcaatcaacttactggccaaaagtctt
aagaaacctgaacgtttctgcggtatgcacttctttaaccctgtgcacaaaatgccatta
gttgaaattatccgtggtgagcatagctctgaagaaaccatcgcgacggtagtcgcttac
gccagcaaaatgggtaaaaccccaattgtagtgaatgattgcccaggcttcttcgttaac
cgcgtattatttccatactttgccggatttagtggtctactcgcagaaggcgcagatttt
gccgctgtcgataaagtcatggaaaaacagtttggctggccaatgggcccagcttactta
cttgatgtagtcggtttagatactggtcatcacgctcaagcggtaatggctgaaggcttc
cctgatcgtatgggtaaaaatggcaaagacgctatcgacattatgtttgaaaacaagcgt
ctaggtcagaaaaatgctaaaggtttctatgcttattctgttgaccgtcgtggtaagccg
aaaaaagacattgatccaacaagctacgcattattaggcgaaacgttcggcgaactaaaa
gtatttgagtcagatgatatcatcgctcgctgtatgatcccgatgattatcgaaacggtt
cgttgtttagaagaaggcattattgcatcacctgctgaaggcgatatgggtctagtttac
ggtattggtttccctccattccgtggcggtgtattccgttatttagataccatgggcgtg
gcaaactttgttgccctagcagacaaatacgcccatcttggcggcttatatcaagtgacc
gataccatgcgtaaacttgcagccaacaacggtagttactaccaagcctaa

DBGET integrated database retrieval system