KEGG   Shewanella livingstonensis: EGC82_03305Help
Entry
EGC82_03305       CDS       T05875                                 

Definition
(GenBank) penicillin-binding protein 1A
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
slj  Shewanella livingstonensis
Pathway
slj00550  Peptidoglycan biosynthesis
slj01100  Metabolic pathways
slj01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:slj00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EGC82_03305
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    EGC82_03305
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:slj01003]
    EGC82_03305
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:slj01011]
    EGC82_03305
Enzymes [BR:slj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     EGC82_03305
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     EGC82_03305
Glycosyltransferases [BR:slj01003]
 Polysaccharide
  Bacterial polysaccharide
   EGC82_03305
Peptidoglycan biosynthesis and degradation proteins [BR:slj01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   EGC82_03305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly PCB_OB Transpeptidase HTH_44 hemP
Motif
Other DBs
NCBI-ProteinID: AZG71873
UniProt: A0A3G8LQ05
LinkDB All DBs
Position
complement(739885..742470)
Genome map
AA seq 861 aa AA seqDB search
MKWFKRLLIAFFSLSLLGVAAIAAAYFYVLPDLPDVNSLKTVQLQTPLRIYSRDGKLISQ
FGEKRRIPVEYDEVPAQLINAVLDTEDARFFEHNGIDPIGIIRAALILVTTGKKSQGAST
ITQQVARGFFLSNEKTYIRKVKEIFLALKIEKALSKKEILALYLNRSFLGNRAYGVGAAA
QVYYGKELSQLTLPEMAMIAGLPQAPSAANPIRNPERAISRRNWVLSRMLEKRNITQAEY
QEAINSISTAKYHGAEIDLYAPYVSEMARDYMIQKYGEEAAYTNGYNVYTTISSDLQLMA
QESLRDNVFAYDQRHGYRGPVTELWTDTPLNNEETVTILKRTSSMQGIMPAAVISVKDQQ
AQVIDDEGKLITLEWKGLKWARKFISDKRQSLPPKQASDILTAGQQVWIRHNGKHWQLSQ
IPLVSSATVSLEPHDGAIKTLVGGFSFSQSQFNRVTQAKRQLGSNIKPFIYAAALEKDYT
LATLINNAPINKPDTRQGTAWRPKNSPDIYGGPTRLRVGLAQSINVMSVRAMRYTGLDDT
IKKLIQFGFDPNDLPRNESLALGSPSVTPLQVATAFNSFANGGYLVEPYFIDHVTDSYDN
MIEQTIPSIACSKPAPSIEETAVIDDPFAAMAEEFSQQAVLSSADTSDQETTIDSITAEE
NICTNPKAHFAKRVISEQTAFLITEALKSVIWGGGDWSKGTGWNGTAWRASKLIRRHDIA
GKTGTTNESRDTWFSGFNPTLTATFWVGFDDHGRQLGRSSWMANGDPEQISGAEAGAKTA
GPGWNDYMNKALSGTPEAPVIPPKGIVSARIDLATGKLTRKTDHTTEFEYFAEGTEPKEY
VTDIPQSGDIFIDNVAEDLFQ
NT seq 2586 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtggtttaaacgtttattaatcgcattttttagcctatcactacttggcgttgct
gctatcgcggccgcttacttttatgtattgcctgacttacccgatgttaattcgctaaag
acggtacaattacaaactccgctgcgtatttatagccgcgatggcaaacttatttctcag
tttggtgagaaacgccgtatacctgtcgagtacgatgaggtgcctgctcagttgattaat
gccgtgctcgatacagaagacgcacgcttttttgagcacaatggtattgatcctattggt
attatccgtgcggcacttattttggtgaccacaggtaagaaaagtcaaggcgctagtact
attacccaacaggttgctcgtggattcttcctatctaatgaaaaaacatatattcgtaaa
gttaaagaaatcttcctcgcactaaagattgaaaaggcattgtctaagaaagaaatttta
gctctttacttaaatcgttcatttctcggtaaccgcgcctatggcgttggtgcggcagct
caggtttattatggtaaagagcttagccaacttaccttgcctgagatggcaatgattgca
ggcctaccgcaagctccatctgcagctaaccctattagaaatccagaacgagccatatcg
cgtcgtaactgggtgttaagtcgtatgctcgagaaacgtaatattactcaagcagaatac
caagaagcgattaatagcatttctacggcaaaatatcatggtgctgaaatcgatttgtat
gctccgtatgtttcggaaatggcacgcgattatatgatccagaaatacggtgaagaagca
gcctatactaatggttacaatgtctacaccacgatatcatccgatctccaattgatggct
caggaatcattacgagataacgtttttgcttacgatcaacgccatggctaccgtggccct
gttactgaattatggacagatactccgctaaataatgaggagacggtcactattctaaaa
cgcacgtcttcgatgcagggcatcatgcctgctgctgtaataagtgttaaagaccaacaa
gcacaggttattgatgatgaaggcaagttgattacacttgaatggaaaggcttaaaatgg
gcgcgtaagtttattagcgacaaacgccaaagcttacctccgaagcaagcaagtgacata
ttgaccgctggtcaacaagtgtggatccgccataacggtaaacattggcaattatcacaa
atccctctagtttcgagtgcaactgtgtcgcttgaaccccatgacggtgccattaaaact
ctcgtcggtggatttagttttagtcaaagccagttcaaccgagtcactcaggctaagcgc
caattaggttccaatattaagccttttatttatgctgctgcattagaaaaggattacacc
ttagctacgcttattaataacgcacccatcaacaaacccgatacccgtcaaggcactgca
tggcgtccaaagaactcaccagatatttacggtgggcctactcgcttacgtgtcggttta
gcgcagtctattaacgttatgtctgttagagcgatgcgatataccggtttagacgacact
attaaaaaactcatccagtttggttttgatcccaacgatctaccacgaaatgaatcgtta
gccttaggttcaccgtcggtcacccccctgcaagttgccacggcatttaacagttttgct
aatggtggctatttagtagaaccttactttatcgatcacgtgacagactcatacgacaat
atgattgaacaaacaattccttcaatagcgtgcagtaagccagcgccttctattgaagaa
accgctgttattgatgatccatttgcagcaatggctgaagaattttctcagcaagctgtg
ttgtcatccgcagatacatcagaccaagaaacgacaatagattcaattaccgccgaagag
aacatttgtactaatccaaaggcccattttgcaaaacgagttatttctgaacaaactgca
tttttgattactgaagcattaaaaagtgtgatttggggtggcggtgactggagcaaaggc
acgggttggaatggtacggcatggcgagcatctaaattaattagacgtcatgatattgcc
ggaaaaacaggaacaaccaacgaatctcgtgatacttggttcagtggctttaatcctaca
cttactgcaaccttctgggttgggtttgatgatcacggccgtcagctaggtcgctcaagt
tggatggcaaatggcgatccagagcagatttccggtgctgaagcgggtgcgaaaacagca
ggtcctggttggaatgactatatgaataaagcactctcaggtactcctgaagcaccagtt
attccacctaaaggaatcgtatctgcacgtattgatttagctacgggtaaattgactcgt
aagacagatcacaccacagagtttgaatattttgctgaaggtacagaacctaaagaatat
gtcactgatataccacaaagtggtgatatctttatcgacaatgttgctgaagatttattt
cagtaa

DBGET integrated database retrieval system