KEGG   Shewanella livingstonensis: EGC82_03335Help
Entry
EGC82_03335       CDS       T05875                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase AroK
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
slj  Shewanella livingstonensis
Pathway
slj00400  Phenylalanine, tyrosine and tryptophan biosynthesis
slj01100  Metabolic pathways
slj01110  Biosynthesis of secondary metabolites
slj01130  Biosynthesis of antibiotics
slj01230  Biosynthesis of amino acids
Module
slj_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:slj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EGC82_03335 (aroK)
Enzymes [BR:slj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     EGC82_03335 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_24 Cytidylate_kin2 AAA_33 Cytidylate_kin ABC_tran AAA_22 AAA_16 TsaE His_biosynth Ploopntkinase3 AAA_5 dNK AAA AAA_25 APS_kinase Mg_chelatase ATPase_2 AAA_PrkA AAA_29 AAA_23 AAA_7 Mur_ligase RNA_helicase AAA_28 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AZG71879
UniProt: A0A3G8LQS0
LinkDB All DBs
Position
747958..748473
Genome map
AA seq 171 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRHLAQMLHLDFHDSDHEIEQRTGADIAWVFDVEGEEGFR
RREEQVIGDLSERQGIVLATGGGSVQSKDIRNYLSARGIVVYLETTIDKQVARTQRDKRR
PLLQVDDPREVLESLAEIRNPLYEEIADVIVKTDEQSAKIVANQIIEQLGF
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaaacgcaatatttttctggtaggccctatgggcgcaggtaaaagcacaatt
ggtcgccatctggcgcaaatgctgcatttagatttccacgattcagatcacgagattgaa
caacgtactggtgcagatattgcctgggtgtttgatgtcgaaggtgaggagggcttccgt
agacgtgaagaacaagtcattggtgatctttcagaaaggcaaggtatcgttctcgcgaca
ggtggtggttctgttcagagtaaagatatccgcaattatctttctgctcgaggtatagtg
gtttacttagaaacaacaatcgacaaacaagttgcgcgtactcagcgcgataaacgtcgt
ccgttgttacaagtagatgatccacgtgaagtgcttgaaagtttagcggagatccgtaat
cctttatatgaggaaattgcggatgttatcgttaagactgatgagcaaagcgcgaagatc
gtcgcaaaccaaattatcgagcaacttggcttttag

DBGET integrated database retrieval system