KEGG   Shewanella livingstonensis: EGC82_04125Help
Entry
EGC82_04125       CDS       T05875                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
slj  Shewanella livingstonensis
Brite
KEGG Orthology (KO) [BR:slj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EGC82_04125 (ahpF)
Enzymes [BR:slj01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     EGC82_04125 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like DAO Thi4 Glutaredoxin FAD_oxidored NAD_binding_7 AlaDh_PNT_C K_oxygenase NAD_binding_8 FMO-like RrnaAD
Motif
Other DBs
NCBI-ProteinID: AZG72021
UniProt: A0A3G8LR58
LinkDB All DBs
Position
934779..936344
Genome map
AA seq 521 aa AA seqDB search
MLDANVKNQLKTYLQNLKRPVELVVSADDSNKGKELTSLAQDIIDSSDLVSVTYQQGQRT
PSMSVINPQAATNIIFAGLPMGHEFTSLVLALLHSGGHPIKLDADIIEQIRQLPGKFHFE
TYISLSCQTCPEVIQALNMMAAINPNITNVMIDGALFQQEVSDRNIMSVPSVFLNGEAFS
VGAISVVEVLNKLDKNAAGRQAEQLNQKSVFDMLVVGGGPAGAAAAIYSARKGLVTGIVA
DKFGGQVAETVGIENFISVSKTEGPKLVANLEAHVKDYDVDIMQNQRALSLAKNGLFDVT
LESGATLSSKTIILATGARWREMNVPGEQEYRNKGVAYCPHCDGPLFKGKRVAVIGGGNS
GIEAAIDLANIVEHVTVLEFDSKLRADEVLQRKAKSMGNITIITQAMTTEVKGDGTRVTS
LIYTDRATGESNTVTLAGIFVQIGLVPNTEWLKGVVDMTPRGEIIVDERGQTSIPGVFAA
GDVTNTPYKQIIIAMGSGATASLGAFDYLIRHSEEVDVKAA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcgaatgtaaaaaatcaactgaaaacctatctgcaaaacctcaagcgccca
gttgaacttgtcgtatctgcagatgactcaaataaaggtaaagaactcactagcctagcg
caagacattattgactcatcagacttagtttcagtcacgtatcagcaaggtcagcgtaca
ccaagcatgagtgtgattaacccacaagctgcaaccaacattatctttgctggactgcca
atgggccatgaatttacctcactggtgttagcgctattacacagcggcggacatccgatt
aagttagatgcggatatcattgaacaaatccgtcagttaccgggtaaatttcattttgaa
acctatatttcgttaagttgccaaacctgtcctgaagtgattcaagcactgaacatgatg
gcggctattaaccccaatattactaacgtgatgatcgacggcgctttattccaacaggaa
gtgagcgatcgcaatatcatgtcagtgccatcagtatttttgaacggcgaagccttctct
gttggcgccattagcgttgttgaagtactaaacaaattagataaaaatgcagcaggcaga
caagccgagcaattaaaccaaaagtcagtttttgatatgttagtggttggcggcggccca
gctggcgcagcagcggcaatttactctgctcgtaaaggtttagtcaccggtattgttgcc
gataagtttggcggccaagtggctgaaacggttggtattgagaactttatttcagtgtct
aaaaccgaaggtcctaaattggtggctaaccttgaagcccatgttaaggattatgacgtc
gacattatgcaaaaccaacgtgcgttgagtttagccaaaaatggtctgtttgatgtgacc
ctagaaagtggcgcgacccttagcagtaaaacgataatcttggcaacgggtgcacgttgg
agagaaatgaacgtccctggtgagcaagaataccgtaataaaggcgtagcgtattgccca
cattgtgacggcccattatttaaaggtaaacgtgttgcggtaattggtggcggtaactca
ggtattgaagcggctatcgatttagctaatattgttgaacacgttaccgtacttgaattt
gatagtaagttacgtgccgatgaggtgctacagcgtaaggctaaatcaatgggtaatatt
acgattattactcaagcgatgaccactgaagttaaaggtgatggcactcgtgtgacgagc
ttgatttataccgatagagcaacaggtgaaagcaataccgttacactagcgggtattttt
gttcaaatcggcttagtacctaataccgagtggttaaaaggtgtggttgatatgactcct
cgcggcgaaattattgtcgatgagcgtggccaaacttcaatccctggtgtatttgctgca
ggtgacgtaactaataccccgtataagcaaattattattgccatgggcagcggcgcaaca
gcatcactgggtgcatttgattatctcatcaggcattctgaagaagtggatgtaaaagct
gcataa

DBGET integrated database retrieval system