KEGG   Shewanella livingstonensis: EGC82_08380Help
Entry
EGC82_08380       CDS       T05875                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
slj  Shewanella livingstonensis
Pathway
slj00473  D-Alanine metabolism
slj00550  Peptidoglycan biosynthesis
slj01100  Metabolic pathways
slj01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:slj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    EGC82_08380
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EGC82_08380
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    EGC82_08380
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:slj01011]
    EGC82_08380
Enzymes [BR:slj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     EGC82_08380
Peptidoglycan biosynthesis and degradation proteins [BR:slj01011]
 Precursor biosynthesis
  Amino acid ligase
   EGC82_08380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 RimK
Motif
Other DBs
NCBI-ProteinID: AZG72784
UniProt: A0A3G8LTT0
LinkDB All DBs
Position
complement(1932271..1933281)
Genome map
AA seq 336 aa AA seqDB search
MPRINLLLLCGGGGAEHDISLMSARFFESSLAKSDKFSVRKLVLDQHGHYHTEDGKLCDL
TNRREIRFEDNSTPAWPVDYVIPCIHGFPGETGDIQSYFNLIQLPYFGCESEASNNCFNK
ITAKMWFSALGVPNTPYIFLHQLDDVAIKQTEAAFDKWGSVFVKAASQGSSVGCYKVDVK
ANIAKVLKDAFSYAPYVVVEQTIHARELEVAVYQYQGEVVATLPGEIICDSNTFYSFDEK
YATNSKARTDVVADNLSPEISQRIRDYAVKAFKGMKLRHLSRIDFFLTQDNQILLNEINT
FPGLTPISMFPKMLQNHGHDFTEYLIDVIGQQVDLT
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgccaagaattaatctgctgttattatgcggcggtggtggtgcagaacacgatatttca
ttaatgtcggcacgtttttttgagtcatctctggctaagtcagataaattttcggtacgt
aagttagtactcgaccagcacggacattaccacaccgaagacggtaaattatgcgattta
accaatcgccgtgaaatccgttttgaagataacagcacgccagcttggcctgtcgattat
gttattccgtgcattcatggctttcctggtgaaaccggtgatattcaatcgtactttaat
ttaattcaactcccttattttggttgtgagtcagaagcatctaacaattgctttaacaaa
attaccgctaaaatgtggttttcggctttaggtgtcccaaacacgccttacatcttttta
catcaactagatgatgttgcaatcaagcaaactgaagcggcatttgataaatggggctca
gttttcgttaaagcagcatcacaaggatcgtctgtgggatgctataaagtcgatgtgaaa
gccaatatcgctaaggtacttaaggatgcatttagttatgcaccttacgttgtagttgag
caaaccatccatgcgcgtgaattagaagtcgccgtatatcaataccagggtgaagtagta
gctaccttaccaggtgagattatttgcgacagcaataccttttactcatttgatgaaaag
tacgctacaaatagcaaggctcgcaccgacgttgttgcggataatctcagcccagagatc
agtcagcggatccgtgattacgcagtaaaagcgtttaaagggatgaagttacggcacttg
tcgcgcattgatttctttttaactcaagataatcaaatcctcttaaatgaaatcaatacc
ttccccggattaacgcctatttcaatgttcccgaaaatgttgcaaaaccatggacatgat
ttcactgaatatttaattgatgtgattggacaacaggttgatttaacgtaa

DBGET integrated database retrieval system