KEGG   Shewanella livingstonensis: EGC82_09425Help
Entry
EGC82_09425       CDS       T05875                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
slj  Shewanella livingstonensis
Pathway
slj00020  Citrate cycle (TCA cycle)
slj00190  Oxidative phosphorylation
slj00650  Butanoate metabolism
slj01100  Metabolic pathways
slj01110  Biosynthesis of secondary metabolites
slj01120  Microbial metabolism in diverse environments
slj01130  Biosynthesis of antibiotics
slj01200  Carbon metabolism
Module
slj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
slj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
slj_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:slj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EGC82_09425
   00650 Butanoate metabolism
    EGC82_09425
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    EGC82_09425
Enzymes [BR:slj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     EGC82_09425
    1.3.5.4  fumarate reductase (quinol)
     EGC82_09425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA HI0933_like Pyr_redox_2 DAO FAD_binding_3 FAD_oxidored Thi4 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AZG72964
UniProt: A0A3G8LU97
LinkDB All DBs
Position
2180261..2182027
Genome map
AA seq 588 aa AA seqDB search
MSIPVREFDVIVIGAGGAGMRAALQISKEGKSCALLSKVFPTRSHTVSAQGGITVALGNA
HEDHWEQHMYDTVKGSDFIGDQEAIEFMCQTGPEAIIELEQMGLPFSRFDDGTIYQRPFG
GQSRNFGGEQAARTAAAADRTGHALLHCLYQQNVKHKTDVYSEWYALDLVKNEDDVVVGC
TAIEIETGDIVYFKAKATILATGGAGRIYASTTNAHINTGDGVGMAARAGIQLQDMEMWQ
FHPTGIAGAGTLVTEGCRGEGGYLLNKDGERFMERYAPNAKDLASRDVVARSMMTEIREG
RGLDGPLGPHLLLKLDHLGKETLEARLPGVCELSRTFAHIDPADGPIPVLPTCHYMMGGL
PTKVSGQVIRQNKDGSEQDVLGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGQHLG
KALDATPDPKLASDIEINASLARLNRWESNKDGEEPAVIRKALQLCMQLNFSVFRSGEAM
AEGLEQLQAIQKRLDNAKLSDNSTEFNTQRIECLELDNLMATALATAYSANFRTESRGAH
SREDYLERDDDNWLCHSLFDPVTKNMSKRDVNMTPKLRDAFPPVKRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
gtgagtattccagtacgtgaatttgatgtaatcgtaatcggcgccggcggtgcaggtatg
cgagcagcattacagatttctaaagagggtaagagctgtgcgctgttatctaaagtattc
ccgactcgttcacataccgtttctgctcaaggtggtatcaccgtagcattaggtaatgcg
cacgaggatcattgggaacaacacatgtacgatacggttaaaggttctgattttatcggc
gaccaagaagccattgagtttatgtgtcaaaccggtcctgaagcgattattgaacttgag
caaatgggtttacctttctctcgtttcgacgatggtacaatttatcaacgtccttttggt
ggccagtcaagaaactttggcggcgagcaagcggctcgaactgcagctgctgctgaccgt
acaggtcatgcattacttcattgtttatatcaacaaaacgttaaacataaaactgacgtt
tattctgagtggtatgccttagatttggttaaaaatgaagatgacgttgtagtgggttgt
accgcaattgaaattgaaacaggcgacattgtttatttcaaagccaaagcaacgatacta
gcaacgggtggtgcagggcgtatttatgcttcgaccaccaacgctcatattaacaccggt
gatggtgtaggtatggcagcacgtgctggcattcaattacaagatatggaaatgtggcag
ttccacccaacgggtattgctggtgcaggtaccttagtcactgaaggttgtcgtggtgaa
ggtggttatttattaaataaagacggcgaacgcttcatggagcgctatgcgccgaacgct
aaggatttagcatcgcgcgacgtggtagcacgttcaatgatgactgaaattcgtgaaggt
cgtggtttagacggtcctttaggccctcatttgttactaaagcttgatcatttgggcaaa
gaaacccttgaagcacgtcttcctggagtgtgtgaattatcacgtactttcgctcacatc
gatccggctgatggccctattcctgtattgcctacgtgccactacatgatgggcggttta
ccgactaaagtgagcggtcaagttattcgtcagaataaagatggcagtgagcaggatgta
ttaggtttatttgctgttggtgagattgcttgtgtatcagtacacggtgctaaccgttta
ggcggtaactcattactcgatttagtggtctttggacgtgctgcaggtcaacatttaggt
aaggcgttagacgctacacctgatccaaaactcgcatcagatatagaaataaatgcatca
cttgctcgtcttaatcgttgggaaagcaacaaagatggcgaagaacctgcggttattcgt
aaagcgcttcaattgtgtatgcagttaaatttctccgttttccgcagtggtgaagccatg
gcagaaggtttagaacagctacaagctattcaaaagcggcttgataatgctaagttatct
gacaattcaacagaatttaatacgcaacgtattgagtgcttagaattagataacttaatg
gcaacagcgctggcaactgcctattcagctaacttccgtactgaaagtcgtggtgcgcat
tctcgtgaagattatttagaacgtgatgatgacaattggttatgtcatagcttatttgac
ccagtgactaagaatatgagcaaacgtgatgtcaacatgacacctaaattacgtgatgca
tttccaccagtaaaacgtacctattag

DBGET integrated database retrieval system