KEGG   Shewanella livingstonensis: EGC82_09430Help
Entry
EGC82_09430       CDS       T05875                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
slj  Shewanella livingstonensis
Pathway
slj00020  Citrate cycle (TCA cycle)
slj00190  Oxidative phosphorylation
slj00650  Butanoate metabolism
slj01100  Metabolic pathways
slj01110  Biosynthesis of secondary metabolites
slj01120  Microbial metabolism in diverse environments
slj01130  Biosynthesis of antibiotics
slj01200  Carbon metabolism
Module
slj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
slj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
slj_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:slj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EGC82_09430
   00650 Butanoate metabolism
    EGC82_09430
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    EGC82_09430
Enzymes [BR:slj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     EGC82_09430
    1.3.5.4  fumarate reductase (quinol)
     EGC82_09430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_18 Fer4_9 Fer4
Motif
Other DBs
NCBI-ProteinID: AZG72965
UniProt: A0A3G8LV11
LinkDB All DBs
Position
2182044..2182751
Genome map
AA seq 235 aa AA seqDB search
MKLTFALYRYNPDVDTKPYMKDYTLEVPDGSDMMVLDALIKLKEQDSTIAFRRSCREGVC
GSDGMNMNGKNGLACITPISTFKGKKIEIRPLPGMPVVRDLVVDLTQFYKQYEKIKPYLI
NDEKAPAREHIQSPEERAHLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLHAYRFLI
DSRDTATEERLSDLDDAYSVFRCHGIMNCVDVCPKGLNPTKAIGHIKSMLLKRAV
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaacatttgcattgtatcgttataatcctgatgtagatacaaagccttacatg
aaggattacaccctagaagtgcctgacggttctgatatgatggtgttagatgcgttaatt
aaactgaaagaacaagactcaacgattgcgttccgtcgttcatgccgtgaaggtgtgtgt
ggttctgacggtatgaacatgaatggtaaaaatggattagcgtgtattacgccaatatcg
acctttaaagggaagaaaattgaaatccgtcctttaccaggcatgccagtagtgcgagat
ttggtcgttgacctaactcaattctacaagcaatacgaaaaaattaagccttatctgatc
aatgatgaaaaggcgcctgctcgtgaacatattcaatcacctgaagagcgtgctcattta
gatggtttatacgaatgtattttgtgtgcatgctgttcaacctcgtgtccatctttctgg
tggaatccggataagtttatcggtccagctggtttgttgcatgcttatcgtttcttgatt
gacagccgcgacacggccactgaggagcgtttatctgacctagatgatgcttatagtgta
ttccgttgccatggcattatgaactgtgttgatgtttgtcctaaaggattaaacccaact
aaagcgattggtcatattaagtcgatgttgttaaagcgagcggtttaa

DBGET integrated database retrieval system