KEGG   Shewanella livingstonensis: EGC82_15745
Entry
EGC82_15745       CDS       T05875                                 

Definition
(GenBank) LOG family protein
  KO
K06966  pyrimidine/purine-5'-nucleotide nucleosidase [EC:3.2.2.10 3.2.2.-]
Organism
slj  Shewanella livingstonensis
Pathway
slj00230  Purine metabolism
slj00240  Pyrimidine metabolism
slj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slj00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    EGC82_15745
   00240 Pyrimidine metabolism
    EGC82_15745
Enzymes [BR:slj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.10  pyrimidine-5'-nucleotide nucleosidase
     EGC82_15745
    3.2.2.-  
     EGC82_15745
SSDB
Motif
Pfam: DUF3412 DUF4478 Lysine_decarbox LDcluster4 CBM77
Other DBs
NCBI-ProteinID: AZG74075
UniProt: A0A3G8LY99
LinkDB
Position
3645169..3646533
AA seq 454 aa
MIVKISPRGSLDQLSQLEVERLKQGAKSDLYQLYRNCSLAVLASGLISDSSEALFSRYES
FSINILQRERGIQIELINPPIQAFVDGEIITGIQEHLFAVLRDIIYISNKYENLKHIDLS
NAKHITNVVFDILRNAQAISPMKDPNVVVCWGGHSINAVEYQYTRDVGYQLGLRRLDICT
GCGPGAMEGPMKGAAIAHAKQRVHNARYIGLTEPSIIAAEPPNQIVNELVILPDIEKRLE
AFVRLGHGIVIFPGGAGTAEELLYFLGILLNKDNCDASFPLVLTGPAESADYFTVIDEFV
GATLGAEAQSKYQIIIDDPVKVAQIMKQGMEQVKTYRKQKCDAYQYQWSLKIEPEFQLPF
EPTHDVMANLNLYFQDNKAELAANLRKAFSGIVAGNVKGDTIKLIQQFGPFKIEGDAKLM
LMMDKLLNAFVKQQRMKLPGSAYVPCYNIIKTHE
NT seq 1365 nt   +upstreamnt  +downstreamnt
atgatcgtaaaaattagtccccgtggtagtttagatcaactttctcaattagaagtagaa
cgtctaaaacaaggcgcaaaaagcgacttgtatcaattatatagaaattgctcactagcc
gtattagcctcaggtcttatcagcgacagctctgaagcattgtttagccgctatgaatct
tttagcattaatattttacagcgcgaaagaggcatacaaattgaactcattaatcctcct
atccaagcttttgtcgacggtgaaattatcaccggcattcaagagcatttgttcgcagtg
cttcgcgacattatctatatcagcaataaatacgaaaatttaaaacacattgacttaagc
aatgcaaaacacattactaacgtcgtatttgatattctgcgcaatgctcaggccatctct
ccaatgaaagaccctaatgtcgtagtctgttggggtggacacagtatcaacgcggttgaa
taccaatatactcgagatgtcggttatcaacttggcctgcgtcgattagatatttgtact
ggctgtggacctggcgcaatggaaggaccaatgaaaggcgcggcaattgcccatgccaaa
caacgagtacataatgcccgctatattggtttaactgaacccagtattattgccgctgaa
ccacccaatcaaattgttaatgaattagttattttaccagacatagaaaaacgcttagaa
gcctttgttcgcttgggtcatgggattgttattttccctggcggagctggcacagcagag
gagctactctattttctcggtatcttattaaataaggacaattgcgatgcatcctttcca
ttagtattaaccgggccggcagaaagtgctgactacttcacggtaattgatgagtttgtt
ggggccacattgggcgccgaagcacaaagtaaatatcaaatcattattgacgatccggta
aaagtagcgcaaataatgaaacaaggtatggaacaagtaaaaacataccgtaaacaaaaa
tgtgatgcttaccaatatcaatggtcattaaaaattgaacccgaatttcaactaccgttt
gaaccgactcatgacgtgatggcaaatttaaacctctactttcaggataataaagcagag
cttgccgcaaacttacgtaaagcattttcgggcattgtcgccggtaacgtaaagggcgat
acgattaagttaatccaacagtttggcccctttaagattgaaggtgatgctaaattgatg
ctaatgatggataagcttttaaacgcttttgttaaacaacaacgaatgaaactaccagga
agcgcttacgtgccctgctacaacataataaaaacacatgaataa

DBGET integrated database retrieval system