KEGG   Shewanella livingstonensis: EGC82_17890Help
Entry
EGC82_17890       CDS       T05875                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
slj  Shewanella livingstonensis
Pathway
slj00550  Peptidoglycan biosynthesis
slj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slj00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EGC82_17890
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:slj01002]
    EGC82_17890
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:slj01011]
    EGC82_17890
Enzymes [BR:slj01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     EGC82_17890
Peptidases [BR:slj01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   EGC82_17890
Peptidoglycan biosynthesis and degradation proteins [BR:slj01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   EGC82_17890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 CytoC_RC TfuA
Motif
Other DBs
NCBI-ProteinID: AZG74455
UniProt: A0A3G8LZA3
LinkDB All DBs
Position
4113405..4114616
Genome map
AA seq 403 aa AA seqDB search
MMTSKTAQLTTMLLASVVCFSSLAATPQPDIRPTPNRAPMVTPDAPSVAAKAYVLMDYNS
GRVIAEENAYESLNPASLTKMMTSYVIGHEIRVGNISLDDDVAITKNAWAKNFPDSSKMF
IEVGKTVKVHDLNRGIIIQSGNDACVAMAEHIAGTEGAFVDLMNSWAKQLGMKDSYFENS
HGLDSENHKTTAYDMAILGAALIRDVPEEYKVYSEKSFTYNGIKQYNRNGLLWDKSLNVD
GIKTGHTSGAGYNLVSSGTSEGMRLISVVMGTSSESARKAESKKLLNYGFRFFETITPYK
AGDTFVTQQIWYGDRETVDLGVITDTPITISRGKAKDLQANFELTKPLTAPLAKGETVGR
VFFQLDGKDIAQFPLVTLNEVQEGSWFSKLMDYFKQMFASWFE
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgatgacttccaaaaccgctcaattaacaacgatgctcttggcatcagttgtctgtttt
tcttcactcgcagcaacgccacaacctgatatacgtccaacaccaaatcgtgctcctatg
gttacaccagacgcaccaagtgttgcggctaaagcctatgtgctaatggattataattct
ggcagagtcattgccgaagaaaatgcttacgaaagtttaaacccagcaagtctgacgaaa
atgatgaccagttatgtcattggccatgaaatccgcgttggtaatatttcacttgatgat
gatgtcgctattactaaaaatgcttgggcaaagaatttcccagactcatctaaaatgttt
attgaagtgggtaagacagtcaaagtacacgacttaaaccgcggtattattattcaatcg
ggtaatgatgcctgcgttgcaatggctgaacacattgctggtactgaaggggctttcgtt
gatctaatgaactcatgggccaagcaattgggcatgaaagatagttactttgaaaactct
catggtttagattcagaaaatcataaaaccacagcttatgatatggccattttaggtgca
gcgcttattcgtgatgtgccagaagaatacaaagtctattcagaaaaatcgtttacgtat
aatggcattaagcaatataaccgtaatggattattatgggataaaagcttaaatgttgat
ggtattaaaacgggccacacatctggtgcaggttacaacctagtatcatcaggtactagc
gaaggtatgcgccttatcagcgtagtgatgggcacatcaagtgaatcggcccgtaaagct
gaaagcaaaaaactgcttaactatggtttccgtttctttgaaaccattacgccgtataaa
gctggcgatactttcgtaacgcaacaaatttggtatggcgatagagaaaccgttgatctc
ggtgttatcactgatacccctattacgattagccgtggtaaagcaaaagatttgcaagct
aactttgaattaactaagccgttaactgctccgctagctaaaggcgaaacagtcggtagg
gtctttttccaacttgacggaaaagacattgctcagttcccattagtgacattaaatgaa
gtccaagaaggcagttggttcagtaagctaatggattactttaagcaaatgtttgctagt
tggtttgagtaa

DBGET integrated database retrieval system