KEGG   Streptomyces lunaelactis: SLUN_21385
Entry
SLUN_21385        CDS       T06347                                 

Definition
(GenBank) O-aminophenol oxidase
  KO
K20204  grixazone synthase / o-aminophenol oxidase [EC:1.10.3.15 1.10.3.4]
Organism
slk  Streptomyces lunaelactis
Pathway
slk00380  Tryptophan metabolism
slk00997  Biosynthesis of various secondary metabolites - part 3
slk01100  Metabolic pathways
slk01110  Biosynthesis of secondary metabolites
Module
slk_M00905  Grixazone biosynthesis, aspartate 4-semialdehyde => grixazone B
Brite
KEGG Orthology (KO) [BR:slk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    SLUN_21385
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    SLUN_21385
Enzymes [BR:slk01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.3  With oxygen as acceptor
    1.10.3.4  o-aminophenol oxidase
     SLUN_21385
    1.10.3.15  grixazone synthase
     SLUN_21385
SSDB
Motif
Pfam: Tyrosinase
Other DBs
NCBI-ProteinID: AVZ74334
UniProt: A0A2H5BVB1
LinkDB
Position
complement(4645482..4646405)
AA seq 307 aa
MVPVRKNHLNMTAGEKRRFIRAVRRVKQLGIYDELVRIHIQINSGDYLDKDGGVGKRWGH
MSPGLFPWHRQYLLVLERALQQVDPTVTIPYWDWTKDQSLDSPLWADTFMGGNGRPGDRK
VMTGPFARCNGWKLNVSVVPVGDEHPAFNGHYTADDRDYLVRDIGTVNPALPTVKELEDT
LALTTYDTPPYNYTSGYGTETQSLRNHLEGYAKFPWEENLGKLHGAGHTWMGGHMLYIGS
PNDPIFFMHHCFIDKLWSIWQKTHPDVPHYLPLTEHPDVPSLGTKLAPWYSMSPADLLDH
SNFYSYA
NT seq 924 nt   +upstreamnt  +downstreamnt
atggttcccgtccggaagaaccatctcaacatgaccgccggggagaagagacgtttcatc
cgcgcggtccgcagggtgaagcaactcggcatctacgacgagctggtccgaatccacatc
cagatcaactcgggcgactacctggacaaggacgggggcgtcggcaaacgctggggccac
atgagcccgggcctgttcccgtggcaccgccagtacctgctggtcctcgaaagggcgctc
cagcaggtcgaccccaccgtcaccatcccttactgggactggaccaaggaccagagcctg
gactcgccgctgtgggccgacaccttcatgggcgggaacggccggcccggcgaccggaag
gtcatgaccggcccgttcgcccgctgcaacgggtggaagctcaacgtcagcgtggtgccg
gtcggcgatgagcacccggcgttcaacggtcactacacggcggacgaccgggactacctc
gtccgcgacataggcaccgtgaatccggccctgccgacggtcaaggagctggaggacact
ctcgcgctcacgacctacgacactccgccttacaactacacctccggctacggaactgag
acgcagtccctgcgcaaccacctggagggatacgcaaagttcccctgggaggagaacctc
ggcaagctgcacggcgccggccacacgtggatgggcggccacatgctgtacatcggatcg
ccgaacgaccccatattcttcatgcaccactgcttcatcgacaagctctggtcgatctgg
cagaagacgcatccggacgtcccgcactacctcccgctgaccgaacacccggatgtcccg
tcactgggtacgaagctcgcgccctggtactcgatgtcacccgccgatctgctggatcac
tcgaatttctacagctacgcgtaa

DBGET integrated database retrieval system