KEGG   Streptomyces lunaelactis: SLUN_21415
Entry
SLUN_21415        CDS       T06347                                 

Definition
(GenBank) 2-amino-4,5-dihydroxy-6-one-heptanoic acid-7-phosphate synthase
  KO
K18287  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase [EC:4.1.2.56]
Organism
slk  Streptomyces lunaelactis
Pathway
slk00997  Biosynthesis of various secondary metabolites - part 3
slk01100  Metabolic pathways
slk01110  Biosynthesis of secondary metabolites
Module
slk_M00905  Grixazone biosynthesis, aspartate 4-semialdehyde => grixazone B
Brite
KEGG Orthology (KO) [BR:slk00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    SLUN_21415
Enzymes [BR:slk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.56  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase
     SLUN_21415
SSDB
Motif
Pfam: DeoC PucR TMP-TENI
Other DBs
NCBI-ProteinID: AVZ74338
UniProt: A0A2H5BVB7
LinkDB
Position
4653080..4653853
AA seq 257 aa
MISNGAFGRQLRLRRLYRNDSERLLIVPLDHSVSQGPITGGEGIDALVGQLATNRVDAIV
LHKGSLRHVDPAWFGSTALIVHLSASTVHAPDPDAKYLVAGVEESLRLGADAVSVHVNLG
SDGEQQQISDLAAVADACDRWNVPLLAMMYPRGPKISDPRDPALVAHAVTLAADLGADLV
KTPYVGSVAEMKEITARAPIPVITVGGPRNDDEGQVLAYVTEALSAGVAGVAMGRNVFEA
PDPGVMAAKLANLIHSE
NT seq 774 nt   +upstreamnt  +downstreamnt
atgatctccaacggcgcgttcggcaggcaactccgcctgcggcgcctctaccgaaacgat
tccgaacggctgctgatcgtgccgctggaccattcggtgagccagggaccgataaccggc
ggcgagggaatcgacgcgctcgtgggccagttggccaccaacagggtggacgcgatcgtc
ctgcacaagggcagcctccggcacgtcgatcccgcctggttcggcagcaccgcgctcatc
gtccacctgagcgccagcaccgtgcacgcccccgacccggacgccaagtacctcgtggcc
ggcgtcgaggagagcctgcggctgggcgcggacgcggtgagcgtgcacgtcaacctggga
tcggacggcgagcagcagcagatctccgatctggccgcggtcgccgacgcctgcgaccgg
tggaacgtcccgctgctggcgatgatgtacccccgcggtcccaagatcagcgatccgcgc
gacccggcgctggtggcgcacgcggtgacactggccgccgatctcggcgccgacctggtg
aagaccccgtacgtcggctcggtcgcggagatgaaagagatcaccgcccgcgcgcccatc
ccggtcatcaccgtcggtggcccgcgcaacgacgacgagggccaggtcctggcctacgtg
accgaagcgctgagcgcgggcgtcgcgggcgtggccatgggccgaaacgtcttcgaggcg
cccgaccccggcgtcatggccgcgaaactggccaacctcatccacagtgagtga

DBGET integrated database retrieval system