KEGG   Streptomyces lunaelactis: SLUN_36935Help
Entry
SLUN_36935        CDS       T06347                                 

Definition
(GenBank) hypothetical protein
  KO
K01607  4-carboxymuconolactone decarboxylase [EC:4.1.1.44]
Organism
slk  Streptomyces lunaelactis
Pathway
slk00362  Benzoate degradation
slk01100  Metabolic pathways
slk01120  Microbial metabolism in diverse environments
slk01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:slk00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SLUN_36935
Enzymes [BR:slk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.44  4-carboxymuconolactone decarboxylase
     SLUN_36935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CMD
Motif
Other DBs
NCBI-ProteinID: AVZ76940
UniProt: A0A2R4TCT7
LinkDB All DBs
Position
8090445..8090918
Genome map
AA seq 157 aa AA seqDB search
MTSRRPMSATTSEGCQMNGTNDGEATPPPTVSRRDRGIAAYARIFALPEQEVPAAFAELV
GPEFAEEALQAAGGAGWWHPALTARDRSIAIITALACQGVADKRLRTHVRLGMRHGLDQD
ALTALAALLAGYIGYPRASITMETIKDEYAHTDRTEP
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgacaagccgccggcccatgtcagcgacgaccagcgaaggctgccagatgaacgggaca
aacgacggtgaggccacgccgccacccaccgtgagcaggcgcgaccgcggcatcgcggcc
tacgccaggatattcgcccttcccgagcaggaagtacccgcggccttcgccgaactcgtc
ggaccggaattcgccgaggaggcactccaggccgccggcggggccggatggtggcacccg
gcgcttaccgcacgcgaccgcagcatcgccatcatcacggccctggcctgccagggtgtc
gccgacaaacgcctgcgcacccacgttcggctgggtatgcgacacggacttgaccaagac
gcactcaccgcgctggccgctctgctggccggctacatcggatacccgcgagcctcgatc
accatggaaaccatcaaggacgagtacgcgcacaccgaccgtacggagccgtaa

DBGET integrated database retrieval system