KEGG   Stenotrophomonas sp. LM091: BIZ42_02595Help
Entry
BIZ42_02595       CDS       T04630                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
slm  Stenotrophomonas sp. LM091
Pathway
slm00380  Tryptophan metabolism
slm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    BIZ42_02595
Enzymes [BR:slm01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     BIZ42_02595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AOX61178
UniProt: A0A1D8Y6J3
LinkDB All DBs
Position
573933..575210
Genome map
AA seq 425 aa AA seqDB search
MSEILSRTHAVALDAADPLRSLRNEFVFPQHNHRDQTYFVGNSLGLQPRGARAAVQEVMD
KWASLAVEGHFTGETQWLHYHRLVSDQLARVVGALPSEVVAMNTLSVNLHLMMVSFYRPT
AERPVILMEAGAFPTDRHAVESQLRFHGFNPETDLVEVQPDEPNGTISLQAIERAITEHG
PRLALVLWPGVQYRSGQVFDLEAITRMARLQGARVGFDLAHSVGNVPLQLHDIAPDFAVW
CHYKYLNAGPGAVAGCFVHERHHRDATLPRFAGWWGHEEATRFKMAPQFVPAVGAEGWQL
SNPPVLGLAPLRAALEVVDKAGGIDALRVKSLRLTGMLDALVRARLSGVLEVLTPSEPER
RGCQLSLRVAGGRERGRSLFEYLQTVGVLGDWREPDVIRISPTPLYNRYLDLHHFVEEVE
AWAGL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagatcctcagccgcacccatgccgttgccctggacgccgccgatccgctgcgc
agcctgcgcaacgaattcgtctttccccagcacaaccaccgcgaccagacctacttcgtc
ggcaactcgctgggcctgcagccgcgcggggcacgtgccgccgtccaggaagtcatggac
aaatgggcctcgctggccgtcgaaggccacttcaccggcgagacccagtggctgcactac
caccgcctggtgagcgaccagcttgcccgcgtcgtgggcgccctgcccagcgaagtcgtg
gcgatgaacaccctcagcgtcaacctgcacctgatgatggtcagcttctaccggcccacc
gccgagcgccccgtcatcctcatggaggccggcgccttcccgaccgaccggcatgcggtg
gaatcgcagctccgcttccatggcttcaacccggagaccgacctggtcgaagtgcagccc
gatgagccgaatggcaccatctcgctgcaagccatcgaacgcgccatcaccgagcatggt
ccccgcctggcgctggtgctgtggcccggcgtgcaataccgcagcggccaggtcttcgat
ctggaggccatcacgcgcatggcgcgcctgcagggtgcccgggtcggcttcgatctggcc
cactcggtcggcaacgtgccgttgcagctgcacgacatcgcaccggatttcgccgtgtgg
tgccattacaagtatctcaacgcgggcccgggcgccgtcgccggctgcttcgtgcacgag
cgccaccaccgcgacgccaccctgccgcgtttcgcgggctggtggggccatgaagaggcc
acgcgcttcaagatggccccgcagttcgtgcccgccgtgggcgccgaaggctggcagctc
agcaacccgcccgtgctcggcctggccccgctgcgcgctgcgctggaggtggtcgacaag
gccggcggcatcgacgcgctgcgggtcaaatcgttgcgcctgaccggcatgctggatgca
ctcgttcgcgcgcgcctgtccggcgtgctcgaggtgctgaccccgtccgaaccggaacgc
cgtggctgccagctctcgctgcgcgtggccggtggccgcgagcgcggccgcagcctgttc
gagtacctgcagaccgtgggcgtgctcggcgactggcgcgagcccgatgtgatccgcatt
tcgccgaccccgctctacaaccgctacctcgacctgcaccacttcgtcgaggaagtggaa
gcctgggctggcctctaa

DBGET integrated database retrieval system