KEGG   Stenotrophomonas sp. LM091: BIZ42_04790Help
Entry
BIZ42_04790       CDS       T04630                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
slm  Stenotrophomonas sp. LM091
Pathway
slm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
slm01100  Metabolic pathways
slm01110  Biosynthesis of secondary metabolites
slm01130  Biosynthesis of antibiotics
slm01230  Biosynthesis of amino acids
Module
slm_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:slm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BIZ42_04790 (aroK)
Enzymes [BR:slm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     BIZ42_04790 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 Cytidylate_kin2 AAA AAA_16 AAA_22 AAA_5 TsaE Cytidylate_kin Mg_chelatase CoaE
Motif
Other DBs
NCBI-ProteinID: AOX61567
UniProt: A0A1D8Y7K4
LinkDB All DBs
Position
1072554..1073096
Genome map
AA seq 180 aa AA seqDB search
MNPAPNLILIGPMGAGKTCIGRRLAERFTLDFVDADQAIVDSTGASIPAIFELAGEAGFR
QHERQVLHALLDGHGQLISTGGGAVLDPDNRAAIARRGFVVYLRVSVPAQLERLARDRGR
PLLQRPDREQVLHEMAAARDPLYQGLADLTLDTDLYTPAEATAQLVLRLAAQWQRQETPE
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaatcccgctccgaacctgatcctgattggcccgatgggcgccggcaaaacctgcatc
gggcgccggctggccgagcgcttcacgctggacttcgtggatgccgaccaggccatcgtg
gacagcaccggggccagcattccggcgatcttcgaactcgccggggaagccgggttccgc
cagcacgaacgccaggtcctgcacgctctgctggacggccatggccagttgatctccacc
ggggggggcgccgtgctggacccggacaaccgcgcggccatcgcccggcgcggcttcgtg
gtctacctgcgggtgagcgtgccggcccagctggagcggctggcccgcgaccgcggccgc
ccgctgctgcagcgcccggaccgcgagcaggtgctgcacgaaatggccgccgcccgcgat
ccgctctaccagggcctggccgacctcacgctggataccgatctctacacgcccgccgag
gccactgcgcagctggtgctgcgcctggccgcgcagtggcagcgacaggaaacacccgaa
tga

DBGET integrated database retrieval system