KEGG   Stenotrophomonas sp. LM091: BIZ42_09675Help
Entry
BIZ42_09675       CDS       T04630                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
slm  Stenotrophomonas sp. LM091
Pathway
slm00010  Glycolysis / Gluconeogenesis
slm00620  Pyruvate metabolism
slm01100  Metabolic pathways
slm01110  Biosynthesis of secondary metabolites
slm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:slm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BIZ42_09675
   00620 Pyruvate metabolism
    BIZ42_09675
Enzymes [BR:slm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BIZ42_09675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AOX62452
UniProt: A0A1D8YA66
LinkDB All DBs
Position
complement(2228662..2230191)
Genome map
AA seq 509 aa AA seqDB search
MNAVTSAKPHATDPQSIFKPRYGNYIGGEWVAPRSGQYFENTTPVTGKVFTEVARSNAED
IEAALDAAHAAKAAWAETSTTERANILNRIADRIEENLELLAHAETWDNGKPIRETLNAD
VPLMADHFRYFAGAVRAQEGSLSEIDKDTIAYHFHEPLGVVGQIIPWNFPMLMAAWKLAP
ALAAGNCVVLKPAEQTPASILVLMEVIGDLLPKGVLNVVNGFGVEAGKPLASNPRIAKIA
FTGETTTGRLIMQYASQNLIPVTLELGGKSPNIFFADVMAEDDDFLDKAIEGFVLFAFNQ
GEVCTCPSRALIQESIYEKFMERALKRVAAIKQGNPLDPNTMVGAQASSEQLEKILSYFD
IGKQEGAEVLIGGEQAKLDGDLAGGFYVKPTVFKGHNKMRVFQEEIFGPVVSVTTFKTEE
EALELANDTLYGLGAGVWSRDASRLYRMGRGIQAGRVWTNCYHAYPAHAAFGGYKQSGIG
RENHKMMLDHYQQTKNLLVSYSPKKLGFF
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccgtcacgtccgccaagccgcacgccaccgatccgcagtccatcttcaagccg
cgctacggcaactacatcggcggggaatgggtggcgccgcgcagcggccagtactttgaa
aacaccaccccggtgaccggcaaggtgttcaccgaggtcgcccgttccaacgccgaagac
atcgaagcggcgctcgacgctgcccacgcggccaaggccgcctgggccgagacctcgacc
accgaacgcgccaatatcctcaacaggatcgccgaccgcatcgaggaaaacctcgagctg
ctcgcgcatgccgagacctgggacaacggcaagccgatccgcgaaacgctcaacgccgac
gtgccgctgatggccgaccacttccgctacttcgccggggccgtgcgcgcgcaggaaggc
agcctgtcggagatcgacaaggacaccatcgcctaccacttccacgagccgctcggcgtg
gtcgggcagatcatcccgtggaacttcccgatgctgatggccgcctggaagctggccccg
gccctggccgccggcaactgcgtggtgctcaagccggccgagcagaccccggcttcgatc
ctggtgctgatggaggtgatcggcgatctgctgcccaagggcgtgctcaacgtggtcaat
ggcttcggtgtggaggcgggcaagccgctggcgtccaacccgcgcatcgccaagatcgcc
ttcaccggcgagaccaccaccggccggctgatcatgcagtacgccagccagaacctgatc
ccggtgacgctggagctgggcggcaaatccccgaacatcttcttcgccgatgtcatggcc
gaggatgacgacttcctcgacaaggccatcgaaggcttcgtgctgttcgccttcaaccag
ggcgaggtgtgtacctgcccgtcgcgcgcgctgatccaggaatcgatctacgagaaattc
atggaacgcgcgctcaagcgcgtggccgcgatcaagcagggcaatccgctcgatcccaac
accatggtcggtgcgcaggcctcctccgagcagctggagaaaatcctctcctacttcgac
atcggcaagcaggagggtgccgaggtgttgatcggcggtgagcaggccaagctggacggc
gacctggccggcggcttctacgtgaagcccaccgtgttcaagggccacaacaagatgcgc
gtgttccaggaagagatcttcgggccggtggtttcggtgaccacgttcaagaccgaggag
gaagcgctggagctcgccaacgacaccctgtacggcctcggcgccggcgtgtggagccgc
gatgcgtcgcgcctgtaccgcatgggccgtggcatccaggccggacgcgtgtggaccaac
tgctaccacgcctatccggcacatgccgcgttcggcggctacaagcagtcgggcatcggc
cgcgagaaccacaagatgatgctcgaccactaccagcagaccaagaacctgctggtcagc
tattcgcccaagaagctgggcttcttctga

DBGET integrated database retrieval system