KEGG   Stenotrophomonas sp. LM091: BIZ42_10180Help
Entry
BIZ42_10180       CDS       T04630                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
slm  Stenotrophomonas sp. LM091
Brite
Enzymes [BR:slm01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BIZ42_10180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu LPAM_1 CHRD
Motif
Other DBs
NCBI-ProteinID: AOX62545
UniProt: A0A1D8YAD0
LinkDB All DBs
Position
2348056..2348691
Genome map
AA seq 211 aa AA seqDB search
MRLIHTTLFAAIAALGLTACNKPADTTPEATPAAEATASQPTAEATPEAPPAMTSEAHAN
HTASADLAPTQGNDVKGNVTFSIVDGKVHVKGQVSGLKPNSEHGFHIHEKGDCSAPDGAS
AGGHFNPGKQDHGSVASEPHHGGDMPNIKADAQGNAVVDAPVSTNVNIGKGDDFDIIGRG
LIVHADADDYKTQPTGNAGARLACAVIKAAP
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctgatccacaccacgctgttcgcggccattgccgcgctcggcctgaccgcctgc
aacaagccggccgacaccaccccggaagccacgccggctgccgaagccaccgcgtcccag
ccgacggccgaagcgacccccgaggcaccgccggcgatgaccagtgaggcccatgccaac
cacactgccagtgccgaccttgcgccgacccagggcaatgacgtcaaaggcaacgtgacc
ttcagcatcgttgacggcaaggttcatgtgaaaggccaggtcagcggcctgaagccgaac
agcgagcacggcttccacatccatgagaagggcgactgcagcgcgccggacggcgccagc
gccggcggccacttcaacccgggtaagcaggaccacggcagcgtcgccagcgaaccgcat
cacggtggcgacatgcccaacatcaaggctgatgcccagggcaacgccgtggtcgacgcc
ccggtctcgaccaacgtcaacatcggcaagggtgatgatttcgacatcattggccgcggc
ctgatcgtccatgccgacgcggacgactacaagacccagccgaccggcaatgccggcgca
cgcctggcctgcgcggtgatcaaagcggccccgtaa

DBGET integrated database retrieval system