KEGG   Stenotrophomonas sp. LM091: BIZ42_12375Help
Entry
BIZ42_12375       CDS       T04630                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
slm  Stenotrophomonas sp. LM091
Pathway
slm00473  D-Alanine metabolism
slm00550  Peptidoglycan biosynthesis
slm01100  Metabolic pathways
slm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:slm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BIZ42_12375
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BIZ42_12375
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BIZ42_12375
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:slm01011]
    BIZ42_12375
Enzymes [BR:slm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BIZ42_12375
Peptidoglycan biosynthesis and degradation proteins [BR:slm01011]
 Precursor biosynthesis
  Amino acid ligase
   BIZ42_12375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 ATPgrasp_ST GARS_A ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: AOX62930
UniProt: A0A1D8YBI6
LinkDB All DBs
Position
2849357..2850340
Genome map
AA seq 327 aa AA seqDB search
MNALTFPPLRLTDPAMFGRVAVLLGGTSSERNVSLDSGRNVIEALRARGVDAIAVDGIPA
LALALVEKRFDRVFNILHGHNGGGEDGIVQGLMEAFGVPYTGSDVLGSALSMDKIRTKQV
WISHGLPTPRFIALDQASDVHAAAAELGLPVVVKPANEGSSVGISRVVEEAGLDEAVALA
VRYDGQLLMEQMVVGDELTVAILGDQALPSIRIVPKGQWYDYNAKYIAEDTQYLCPGLEG
EDEIEIRRLALAAFRAAGCRGWGRVDVMRDRSTGRFYLLEVNTAPGMTSHSLVPKSASQA
GIGFEELVWRVLEQTLPGHAAQENRHA
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgctgaccttcccgccactgcgcctcaccgatccggccatgttcggccgcgtt
gccgtgctgctcggtggcacctccagcgagcgcaacgtctcgctggattcgggccgcaac
gtgatcgaagcgctgcgcgcgcgcggcgtcgatgcgatcgccgtcgatggcatcccggcc
ctggcgctggcgctggtcgagaagcgtttcgaccgcgtcttcaacatcctccacggccac
aacggcggtggtgaggacggcatcgtgcagggcctgatggaggccttcggcgtgccgtac
accggctcggacgtgctcggctcggcgctgagcatggacaagatccgcaccaagcaggtg
tggatctcgcacggcctgccgaccccgcgcttcatcgcgctggaccaggcctccgatgtc
cacgccgccgcagccgagctcggcctgccggtggtggtcaagccggccaacgaaggctcc
agcgtcggcatcagccgcgtggtggaagaggccggcctggatgaggcggttgcactggca
gtgcgctatgacggccagctgctgatggagcagatggtggtcggcgacgagttgaccgtg
gcgatcctgggcgaccaggcgctgccgtcgatccgcatcgtgcccaagggccagtggtac
gactacaacgccaagtacatcgccgaggacacccagtacctgtgcccggggctggaaggc
gaggacgagatcgagatccgccgccttgcactggccgcgttccgcgctgccggttgccgc
ggctggggccgggtggacgtgatgcgtgaccgcagcacgggccgcttctacctgctggaa
gtgaacaccgcgccgggcatgaccagccattcgctggtgcccaagtcggccagccaggcc
gggatcggctttgaagagctggtctggcgcgtactggaacagaccctgccgggtcacgca
gcgcaggagaaccgccacgcatga

DBGET integrated database retrieval system