KEGG   Stenotrophomonas sp. LM091: BIZ42_12740Help
Entry
BIZ42_12740       CDS       T04630                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
slm  Stenotrophomonas sp. LM091
Brite
KEGG Orthology (KO) [BR:slm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BIZ42_12740
Enzymes [BR:slm01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BIZ42_12740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like DAO AlaDh_PNT_C FAD_oxidored NAD_binding_8 Thi4 Glutaredoxin FAD_binding_3 K_oxygenase Thioredoxin_4 FMO-like
Motif
Other DBs
NCBI-ProteinID: AOX62995
UniProt: A0A1D8YBK9
LinkDB All DBs
Position
complement(2925773..2927365)
Genome map
AA seq 530 aa AA seqDB search
MLDANLQSQLKTYLERVTRPIQITAHVDDGAKSQEMLELLNTLTTLSAQISLDVRRDSSE
RTPSFALTTPGQDIHLAFAGLPMGHEFTSLVLALLQVGGHPSKATAELIEQVRNLEGEYR
FETYFSLSCQNCPDVVQALNLAAVLNPRIQHVAIDGGLFPAEVEARQIMSVPTVYLNGEV
FDQGRMTLEQIVAKLDTGAAKRDAEKLSTKAPFDVLVVGGGPAGAAAAIYAARKGIRTGV
AAERFGGQVLDTMAIENFISVKETEGPKLAAALEQHVREYEVDIMNLQRATALVPAGDDG
LVEIKLENGASLKSRSVILSTGARWRQMNVPGEDQYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGLVTHVTLLEFDDKLRADEVLQKKLRSLGNVTIITSALTQEVLGDG
QKVTGLVYQDRVGGDSHRVELEGIFVQIGLLPNTEWLKDTVALSPRGEILIDDRGQTSVP
GVFAAGDCTTVPYKQIVIAMGAGSTAALSAFDHLIRTSVPKSSGAVAEAA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgccaacctccagtcccagctgaagacctatctggaacgtgtcacccgtccg
atccagatcacggcgcacgtggatgacggcgccaagtcgcaggagatgctcgagctgctg
aacacgctgaccacgctgtcggcgcagatcagcctggacgtgcgtcgcgacagcagcgag
cgcacgccctccttcgcgctgaccacgcccggccaggacatccatctggcgttcgcgggc
ctgccgatgggccatgagttcacctcgctggtgctcgccctgctgcaggtcggcggccac
ccgtccaaggccacggccgagctgatcgagcaggtgcgcaacctggaaggcgagtaccgc
ttcgaaacctacttctcgctgtcctgccagaactgcccggacgtggtgcaggcattgaac
ctggcggcggtgctgaatccgcgcatccagcacgtggcgatcgatggcggcctgttcccg
gccgaggtggaagcgcgccagatcatgtccgtgccgaccgtgtacctcaacggcgaagtg
ttcgaccagggccgcatgacgctggaacagatcgtggccaagctcgataccggcgcggcc
aagcgcgatgccgaaaagctcagcaccaaggcaccgttcgacgtgctggtggtggggggt
ggtccggccggcgcagcggcagcgatctacgccgcacgcaagggcatccgcaccggcgtg
gccgccgaacgcttcggtggccaggtgctggacaccatggcgatcgagaacttcatctcg
gtcaaggaaaccgaaggtccgaagctggccgccgcgctggaacagcacgtgcgcgagtac
gaggtggacatcatgaacctgcagcgcgccaccgccctggtgcccgccggcgatgatggc
ctggtcgaaatcaaactggaaaacggtgcatcgctgaaatcgcgttcggtgatcctttcc
accggtgcacgctggcgccagatgaacgtgcccggcgaagatcagtaccgcaacaagggc
gtggcgtactgcccgcattgcgacggtccgttgttcaagggcaagcgcgtggcggtgatc
ggtggcggcaactccggcgtggaagcagcgatcgatctggcgggccttgtgacgcatgtg
acccttctggaatttgatgacaaactgcgcgccgatgaagtactgcagaagaagcttcgc
agcctgggcaacgtcaccatcatcaccagcgccctcacccaggaagtgctgggcgatggc
cagaaggtgacgggcctggtctaccaggaccgcgtcggtggcgattcgcaccgggtggaa
ctggaaggcatcttcgtgcagatcggtcttctgcccaataccgaatggttgaaggacacg
gtggcgctgtcaccgcgtggcgagatcctgatcgacgaccgcggccagaccagcgtgccg
ggtgtcttcgccgcaggcgattgcacgaccgttccgtacaagcagatcgtcatcgcgatg
ggcgccggttccactgcggcactgagcgcctttgatcacctgatccgcacctccgttccc
aagagcagcggcgctgtcgccgaagctgcctga

DBGET integrated database retrieval system