KEGG   Stenotrophomonas sp. LM091: BIZ42_15375Help
Entry
BIZ42_15375       CDS       T04630                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
slm  Stenotrophomonas sp. LM091
Pathway
slm00061  Fatty acid biosynthesis
slm00780  Biotin metabolism
slm01100  Metabolic pathways
slm01212  Fatty acid metabolism
Module
slm_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:slm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BIZ42_15375
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BIZ42_15375
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:slm01004]
    BIZ42_15375
Enzymes [BR:slm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     BIZ42_15375
Lipid biosynthesis proteins [BR:slm01004]
 Fatty acid synthase
  Component type
   BIZ42_15375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT PS-DH MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: AOX63456
UniProt: A0A1D8YCY6
LinkDB All DBs
Position
complement(3487367..3487822)
Genome map
AA seq 151 aa AA seqDB search
MSNNQNLPDINQIQQLIPHRYPFLLVDKVISLDFENRKIVATKNVSINEPFFQGHFPGQP
IMPGVLIIEAMAQAGGVLTQLTLGRDAQSKLFYMVKVDKARFSKQVVPGDVLEMHVEIKR
VIRNMAVYDCVAKVDGEIVACAEVLCAGTRE
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaaccagaatctgccggacatcaaccagatccagcagttgatcccgcaccgc
tatccgttcctgctggtggacaaggtgatctcgctcgatttcgagaaccggaagatcgtc
gccaccaagaacgtcagcatcaacgagccgttcttccagggccacttcccgggccagccg
atcatgcccggcgtgctgatcatcgaagccatggcccaggccggcggcgtgctcacccag
ctcaccctgggccgcgatgcgcagtccaagctgttctacatggtcaaggtggacaaggcc
cgtttcagcaagcaggtcgtgcccggcgatgtgctggaaatgcacgtggagatcaagcgc
gtgatccgcaacatggcggtgtacgactgcgtggccaaggtcgatggcgagatcgtcgcc
tgcgccgaagtgctgtgcgccggcacccgcgaatga

DBGET integrated database retrieval system