KEGG   Staphylococcus lugdunensis N920143: SLUG_00070Help
Entry
SLUG_00070        CDS       T01951                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K17758  ADP-dependent NAD(P)H-hydrate dehydratase [EC:4.2.1.136]
Organism
sln  Staphylococcus lugdunensis N920143
Brite
KEGG Orthology (KO) [BR:sln00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SLUG_00070
Enzymes [BR:sln01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.136  ADP-dependent NAD(P)H-hydrate dehydratase
     SLUG_00070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carb_kinase Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: CCB52400
LinkDB All DBs
Position
complement(9834..10652)
Genome map
AA seq 272 aa AA seqDB search
METLNSVNIPKRKDETHKGDYGKILLIGGTVNLGGAIMLAARACVFSGSGLITVATHPTN
HSALHSRCPEAMVIDINDTKMLTKMIENTDCILIGPGLGCDFKGNNAITFLLQNIQPHQT
LIVDGDAITIFSKLKPEIPTCHVIFTPHQKEWERLSGIPIEEQTYERNREAVDKLGATVV
LKKHGTEIYFKEEDYKLTIGSPAMATGGMGDTLAGMITSFVGQFDNYKDAVTSATYTHSY
IGEKLSEKMYVVPPSTLISKIPYVMKELEVKA
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgttaaattcagttaatatccctaaaagaaaagatgaaacacataaaggtgat
tacggcaaaatattactcattggtggaacagtaaatttaggtggcgcaattatgctagca
gcacgcgcttgtgtttttagtggtagtggattgattacggtcgcaacgcatcctacaaac
cattcagcgttgcattcacgttgcccagaagccatggttatcgatattaatgacactaaa
atgttgactaaaatgattgaaaataccgattgtatcctgattggtccagggctaggttgt
gattttaaaggcaacaatgcgattacattccttttacaaaatattcagcctcatcaaacc
ttgattgttgatggcgatgcaattacaatttttagcaagcttaaaccagaaattccgaca
tgtcacgttatatttacgccacatcaaaaggaatgggaacgtttaagtggtattccaatt
gaagaacaaacttacgaacgtaatcgcgaagcagttgataaacttggtgcaacagttgtc
ttaaaaaaacatggtacagaaatctatttcaaagaagaagattacaaacttactattggt
agcccagcaatggctacaggtggcatgggtgatacacttgcaggtatgattacaagcttt
gtaggacaatttgataactataaagacgctgtcacaagtgccacatatacacatagctac
attggtgaaaaactctctgaaaaaatgtacgttgtaccaccttcaactttaatcagtaag
attccatatgtcatgaaagaattagaagttaaagcataa

DBGET integrated database retrieval system