KEGG   Staphylococcus lugdunensis N920143: SLUG_09450Help
Entry
SLUG_09450        CDS       T01951                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sln  Staphylococcus lugdunensis N920143
Pathway
sln00010  Glycolysis / Gluconeogenesis
sln00053  Ascorbate and aldarate metabolism
sln00071  Fatty acid degradation
sln00280  Valine, leucine and isoleucine degradation
sln00310  Lysine degradation
sln00330  Arginine and proline metabolism
sln00340  Histidine metabolism
sln00380  Tryptophan metabolism
sln00410  beta-Alanine metabolism
sln00561  Glycerolipid metabolism
sln00620  Pyruvate metabolism
sln00625  Chloroalkane and chloroalkene degradation
sln01100  Metabolic pathways
sln01110  Biosynthesis of secondary metabolites
sln01120  Microbial metabolism in diverse environments
sln01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SLUG_09450
   00053 Ascorbate and aldarate metabolism
    SLUG_09450
   00620 Pyruvate metabolism
    SLUG_09450
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SLUG_09450
   00561 Glycerolipid metabolism
    SLUG_09450
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SLUG_09450
   00310 Lysine degradation
    SLUG_09450
   00330 Arginine and proline metabolism
    SLUG_09450
   00340 Histidine metabolism
    SLUG_09450
   00380 Tryptophan metabolism
    SLUG_09450
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SLUG_09450
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SLUG_09450
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SLUG_09450
Enzymes [BR:sln01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SLUG_09450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CCB53410
LinkDB All DBs
Position
995616..997043
Genome map
AA seq 475 aa AA seqDB search
MRNFTKQYINGEWVESASNETIDVINPATEEVIGKIAKGNNEDVNKAVQAADEVYLSFRH
SSVDERKALLDKIVAEYKNRKDDIVDAITDELGSPITVSENVHYQMGLNHFQAARDALDT
FQFEEQRGDDLVVKEAIGVAGLVTPWNFPTNQTSLKLAAAFAAGSPVVLKPSEETPFAAI
ILAEIFDKVGVPKGVFNLVNGDGEGVGTPLSEHPKVRMMSFTGSGPTGAKIMEKAAHDFK
KVSLELGGKSPYIVLDDVDIKEAAKATKGKVVNNTGQVCTAGTRILVPNSIKEEFLTALK
EEFSQVVVGDPRNEDTEVGPIVSKKQFDTVQSYIDKGIAEGAELFYGGPGKPEGLDVGYF
VRPTVFVNVDNQMTIAQEEIFGPVASVITYNDLDEAIRIANDTKYGLAGYVIGQDKDTLI
KVARSIEAGTVEINEAGRKPDLPFGGYKQSGIGREWGDYGIDEFLEIKSIAGYYK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatttcactaaacaatatataaacggtgaatgggttgaaagtgcgagcaatgaa
acaatagacgttattaatccagccactgaagaagtaatcggtaaaatagcaaaaggaaat
aatgaagatgttaataaagctgtccaagctgcagatgaagtttatttatcatttagacat
agtagcgtggatgaaagaaaagcattgttagataaaattgttgctgaatataagaataga
aaagacgatatcgttgatgccattacagatgaactaggttcacctattacagtatcagaa
aatgtacattatcaaatgggacttaaccatttccaagctgcacgagatgctttagatact
ttccaatttgaagaacaacgtggtgatgatttagttgttaaagaggcaattggtgttgct
ggtttagtcacaccttggaatttcccaacaaatcaaacatcacttaaattagcggcagcg
tttgcagcaggtagtcctgtcgtgttaaaaccgtctgaagagacaccttttgcagcaatt
attttagctgaaattttcgataaagtaggcgttcctaaaggtgtatttaacttggtaaat
ggcgacggtgaaggcgttggtacaccattaagtgaacatccaaaagtaagaatgatgtct
ttcacaggttctggtccaacaggtgccaaaataatggaaaaagctgcgcatgattttaaa
aaagtgtcacttgaattgggaggtaaatcaccttatatcgtccttgatgatgttgatatt
aaagaagctgcaaaagcaacaaaaggtaaagttgttaataatacaggacaagtgtgtaca
gctggaacaagaatattagttcctaatagtattaaagaagaatttttaacggctttaaaa
gaagagttcagtcaagtagtggtaggagatcctcgtaatgaggacactgaagttggccca
atagtaagcaaaaagcaatttgatacggtacaatcctatattgataaaggcattgctgaa
ggcgcagaattgttttacggaggtcctggcaaacctgaaggcttggatgttggctatttt
gttcgtccaacagtatttgtcaatgttgataatcaaatgacaattgcacaagaagaaata
ttcggtccggttgcctctgtgatcacgtataatgatctagatgaagctattcgtatagca
aatgatacaaaatacggtctggctggttatgtgattgggcaagataaagacacattaatt
aaagtagctcgtagcattgaagctggcacagtagaaattaatgaagcaggcagaaaacca
gatttaccattcggcggttataaacaatcaggaattggacgcgaatggggcgattatggt
attgatgaattcttagaaatcaagtctatagctggatattataaataa

DBGET integrated database retrieval system