KEGG   Staphylococcus lugdunensis N920143: SLUG_09640Help
Entry
SLUG_09640        CDS       T01951                                 

Gene name
atpC
Definition
(GenBank) ATP synthase epsilon chain
  KO
K02114  F-type H+-transporting ATPase subunit epsilon
Organism
sln  Staphylococcus lugdunensis N920143
Pathway
sln00190  Oxidative phosphorylation
sln01100  Metabolic pathways
Module
sln_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:sln00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SLUG_09640 (atpC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:sln00194]
    SLUG_09640 (atpC)
Photosynthesis proteins [BR:sln00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   SLUG_09640 (atpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_DE_N ATP-synt_DE DUF2016 Ribosomal_TL5_C
Motif
Other DBs
NCBI-ProteinID: CCB53431
LinkDB All DBs
Position
1012386..1012787
Genome map
AA seq 133 aa AA seqDB search
MNTLNLDIVTPNGSVYKREDVELVVLQTTAGEMGIMSGHIPTVAALKTGHIKVRFHNGSE
YLAVSGGFVEVRQHKLSVIVQTAETAEEIDVERAKLAKQRAQSHLNDEDNSDIYRAQRAL
ARAENRLRVANLK
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgaatacattaaatctagatattgtcactcctaatggttcagtctacaaaagagaagat
gttgaacttgttgtgttacaaaccacagcaggtgaaatgggtatcatgagtggacatatt
ccgacagtagccgcattaaaaacaggccatatcaaagttagatttcacaatggttctgaa
tacttagctgttagtggtggctttgttgaagttagacaacataaactttctgttattgta
caaacggctgaaacagctgaagaaatagacgtagaaagagctaaattggctaagcaacgt
gcccaatctcatttgaatgatgaagataatagtgatatttatcgcgcacaacgcgcactt
gctagagcagaaaatagattacgagtagctaacttaaaataa

DBGET integrated database retrieval system