KEGG   Staphylococcus lugdunensis N920143: SLUG_16830Help
Entry
SLUG_16830        CDS       T01951                                 

Gene name
pknB
Definition
(GenBank) serine/threonine-protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sln  Staphylococcus lugdunensis N920143
Brite
KEGG Orthology (KO) [BR:sln00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sln01001]
    SLUG_16830 (pknB)
Enzymes [BR:sln01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SLUG_16830 (pknB)
Protein kinases [BR:sln01001]
 Serine/threonine kinases: Other
  Bacterial family
   SLUG_16830 (pknB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Kinase-like Pkinase_fungal RIO1 ABC2_membrane_3 PAP_RNA-bind
Motif
Other DBs
NCBI-ProteinID: CCB54174
LinkDB All DBs
Position
complement(1772966..1774969)
Genome map
AA seq 667 aa AA seqDB search
MIGKIISDRYKVIDKLGGGGMSMVYLAEDMILERQVAIKAISIPPNEKEETLRRFEREVN
NSTQLFSENIVNVYDVDEEDDCFYLIMEYIDGPTLSEYIHTHGPLNIDTAIQFTQQILNG
IQEAHHKRIVHRDIKPQNILIDKNKTLKIFDFGIAKALSETSLTQTNHVLGTVQYLSPEQ
AKGEPTDESTDIYSIGIVLYEMLVGEPPFNGETAVSIAIKHIQDAIPNVTDIRQDVPQAL
SNVILKATEKDVSDRYINIQAMMDDLSSALIDSRANEDKYQHEEETVKTLAIDKNDIKSK
MKESDNKGKIAQTMQIPIVNQRQFQSAEEHVFVPQKKKSSKGKKFLIALIIILLIASLAG
FIAWGVFGDKYEETPDLSGKTEKEAEQLLKEKHLKLGNISRSYSDKYAENQIINSKPEAG
SRINQGDAVDIVLSKGPEKVTMPYVVGMTKAKAQEKLKSLGLNHISIKKDYSRTVAKGLI
AKQNLPADSKVRLNDHHIELIESLGVRQVFVKDYEGKAYSTAKKELEEDGLKVKVTTEAS
DSVKKGNVISQSPKDKEVDEGSTIQLKVSKGEDTDSDEDKNDEDGDSDDVKTHSETVDIP
YSGKDDESQTVDIYIRDEDHKASEVARSFKIKDDKSTTISLKIKKGTTAGYTVRVDNKIV
LDKDVDY
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgatcggaaaaataattagtgatcgttataaagtgattgataagcttggtggcggcgga
atgagtatggtttacttggctgaagatatgattcttgaacgtcaagtagcgattaaggca
atttctattccaccaaacgaaaaggaagaaactcttcgccgtttcgagcgtgaagtgaat
aactcgacgcaacttttcagtgaaaatatcgtcaatgtttatgatgttgatgaagaagac
gattgtttctatttaattatggaatatattgatggaccaacgttatctgaatatatacat
acacacgggccacttaacattgatactgcaattcagttcacgcaacaaatattgaatgga
attcaggaagcgcatcataaaagaattgttcatcgtgatattaaaccccaaaatatttta
atcgataaaaataaaacactaaaaatatttgattttgggattgcaaaagcgctaagtgag
acatcattaactcaaacaaatcacgtattaggtaccgtgcaatatttatcaccagaacaa
gcaaaaggtgagccaacagatgaatcaaccgatatatattcgattggcatcgtattgtat
gaaatgttagttggtgagccaccttttaatggagaaacggcagttagtattgcaattaaa
catatccaagatgcaattccgaacgttacagatattagacaagatgtacctcaagcactt
agcaatgttatcttaaaagcgacggaaaaagatgtaagcgatcgttatattaatatacaa
gctatgatggatgatttgagtagtgcacttatcgatagccgtgcaaatgaggataaatat
caacacgaagaagaaactgtaaaaacattggctatcgataaaaatgatattaaaagtaaa
atgaaagaatctgacaataaaggtaaaattgcgcaaacaatgcaaatacctattgtaaat
caacgacaatttcaatcagcagaggagcatgtttttgttcctcaaaagaaaaaatcgtca
aaagggaaaaagtttttaattgctttaatcataatattattaattgctagtttagctggt
tttatcgcatggggtgtctttggagataaatatgaagaaacaccagatttaagtggtaaa
acggaaaaagaagcagaacaattactcaaagagaaacatttgaagttaggcaatatatct
agaagttatagtgataagtatgcggaaaatcaaatcattaactctaagccagaagcaggt
tcacgtatcaatcaaggtgatgcagtagatattgtgttatcaaaaggtcctgaaaaggtc
acaatgccttatgttgttggaatgacaaaggcaaaagcccaagaaaaattaaagtcatta
ggtttgaatcatatctctatcaaaaaagattacagtcgcacagtggctaaaggattgata
gcaaaacaaaatctaccagctgacagcaaggttaggcttaatgaccatcatattgaacta
attgaatcactaggtgttagacaagtatttgttaaagattatgagggcaaagcctattca
actgcgaaaaaagaattagaagaagatggtttaaaagttaaagtaactacagaagcaagt
gatagtgtcaaaaaaggaaacgtcatttcacaatcaccaaaagataaagaagtagatgaa
ggttcgacgattcaattgaaagtttcaaaaggcgaagatacagattcagacgaggataaa
aatgatgaagatggtgattcagatgatgttaaaacccattctgaaacagtagatattcca
tactctggaaaagatgatgaaagccaaacagtagatatttacattcgtgatgaggaccat
aaagcgtcagaagttgcacgaagttttaaaattaaagatgataaaagcactacgatttct
ttgaaaataaaaaaaggaacaacggcaggctatacagtgcgtgttgataataaaattgta
ttggataaagatgtggattattaa

DBGET integrated database retrieval system