KEGG   Staphylococcus lugdunensis N920143: SLUG_17290Help
Entry
SLUG_17290        CDS       T01951                                 

Gene name
sdhB
Definition
(GenBank) putative succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
sln  Staphylococcus lugdunensis N920143
Pathway
sln00020  Citrate cycle (TCA cycle)
sln00190  Oxidative phosphorylation
sln00650  Butanoate metabolism
sln01100  Metabolic pathways
sln01110  Biosynthesis of secondary metabolites
sln01120  Microbial metabolism in diverse environments
sln01130  Biosynthesis of antibiotics
sln01200  Carbon metabolism
Module
sln_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sln_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SLUG_17290 (sdhB)
   00650 Butanoate metabolism
    SLUG_17290 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SLUG_17290 (sdhB)
Enzymes [BR:sln01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SLUG_17290 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     SLUG_17290 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_10 Fer4_9 Fer4_17 Fer4_2 Fer4 Fer4_16 Fer4_15 Fer4_13 Fer4_21 Fer4_4 Fer4_3 Fer4_6 Fer4_18
Motif
Other DBs
NCBI-ProteinID: CCB54225
LinkDB All DBs
Position
complement(1824996..1825832)
Genome map
AA seq 278 aa AA seqDB search
MTETLSANNTPKDQHADSNQQPQKEKQKTIKLIIKRQDNQDSKPYDEAFEIPYKDNMNVI
ACLMEIRRNPVNAEGKKTTPVIWDMNCLEEVCGACSMVINGRARQSCSAIVDQLEQPIRL
EPMSTFPVIRDLQVDRTRMFDNLKRMKAWIPIDGTYDLGPGPRMPEKKRQTAYELSKCMT
CGVCLEVCPNVTPNNKFVGAQAISQVRLFDLHPTGAMTKDERLDALMGTGGLQECGNSQN
CVNACPKGIPLTTSIAAMNRETTFHMFKSFFGSDHKVE
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaacactatcagcaaataacactccaaaagaccaacatgcagacagtaatcaa
caaccacaaaaagaaaaacaaaaaacaattaaattaattataaaacgtcaagataatcaa
gactctaaaccatacgatgaagcgtttgaaatcccttataaagacaacatgaatgtcatt
gcctgtttgatggaaattagacgtaatccagtaaatgcagaaggaaagaaaacaacgccc
gttatttgggacatgaattgtttggaagaagtttgtggtgcatgttcgatggtaattaat
ggtcgtgcaagacaatcatgttcagccatcgttgatcaattagagcaacctattcgtcta
gaaccaatgagtacgtttccagttattcgtgacttacaagttgaccgtacacgaatgttt
gacaacttaaaacgtatgaaagcttggattcctattgatggaacttatgatttaggtcct
ggacctcgtatgccggagaaaaaacgacaaacagcatatgaactgtcaaaatgtatgaca
tgtggtgtgtgtttagaagtttgtccgaatgtaacacctaataataagtttgtcggtgca
caagccatctcacaagttcgtctatttgatttacatccgacaggtgctatgacaaaggat
gaacgattagatgcattaatggggacaggtggattgcaagagtgcggtaattctcaaaac
tgtgtaaatgcatgtcctaaaggtatcccattaacaacgtcaattgcagcaatgaacaga
gaaacaacgttccatatgttcaaatcattctttggttcagatcataaagtggaataa

DBGET integrated database retrieval system