KEGG   Staphylococcus lugdunensis N920143: SLUG_17300Help
Entry
SLUG_17300        CDS       T01951                                 

Gene name
sdhA
Definition
(GenBank) putative succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
sln  Staphylococcus lugdunensis N920143
Pathway
sln00020  Citrate cycle (TCA cycle)
sln00190  Oxidative phosphorylation
sln00650  Butanoate metabolism
sln01100  Metabolic pathways
sln01110  Biosynthesis of secondary metabolites
sln01120  Microbial metabolism in diverse environments
sln01130  Biosynthesis of antibiotics
sln01200  Carbon metabolism
Module
sln_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sln_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SLUG_17300 (sdhA)
   00650 Butanoate metabolism
    SLUG_17300 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SLUG_17300 (sdhA)
Enzymes [BR:sln01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SLUG_17300 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     SLUG_17300 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 HI0933_like GIDA FAD_oxidored AlaDh_PNT_C NAD_binding_8 Slx4
Motif
Other DBs
NCBI-ProteinID: CCB54226
LinkDB All DBs
Position
complement(1825832..1827598)
Genome map
AA seq 588 aa AA seqDB search
MAEKKIIVVGGGLAGLMSTIKAAEQGAHVDLFSLVPVKRSHSVCAQGGINGAVNTKGEGD
SPWIHFDDTVYGGDFLANQPPVKAMTEAAPQIIHLLDRMGVMFSRTKEGLLDFRRFGGTL
YHRTAFAGATTGQQLLYALDEQVRSFEVDGLVTKYEGWEFLGIVKDEDNAARGIIAQNMT
TSEIQSFGSDAVIMATGGPGIIFGKTTNSMINTGSAASIVYQQGAKYANGEFIQIHPTAI
PGDDKLRLMSESARGEGGRIWTYKDGKPWYFLEEKYPDYGNLVPRDIATREIFDVCINQK
LGINGENMVYLDLSHKDPHELDVKLGGIIEIYEKFTGDDPRKVPMKIFPAVHYSMGGLYV
DYDQMTNIDGLFAAGECDFSQHGGNRLGANSLLSAIYGGTVAGPNAVKYVENIDKTYADL
DDSIYQARVDEEQQRFDNLLNMRGTENAYKLHRELGEIMTANVTVVRENDKLLETDKKIV
ELMERYQNIDMEDTQTWSNQAVFFTRQLWNMLILARVITIGAYNRNESRGAHYKPEFPER
NDEEWLKTTLAEYMGKDEAPKFTYEPVDVSLIPPRKRDYTSKSKGGKK
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaagaaaattattgttgtcggaggcggacttgccggtttaatgtcaacaatt
aaagctgcagaacaaggtgctcatgtggatttgttctcattagtacctgttaaacgttcg
cactctgtatgtgcccaagggggtatcaatggtgcggtaaatacaaaaggtgaaggagat
tctccttggattcattttgatgataccgtttatggtggagattttttagcaaatcaacca
ccagttaaagcaatgactgaagctgcaccacaaattattcatttattagaccgcatgggc
gtcatgtttagcagaacaaaggaaggtttattagactttagacgcttcggtgggacattg
tatcatcgaacagcatttgctggtgcaacaacagggcaacaactattgtatgcgttagat
gaacaagtacgttcctttgaagtagatggactagtgacaaaatatgagggctgggaattt
ttaggaattgttaaagatgaagataatgcagctagaggaattatagctcaaaatatgaca
acttcagaaattcaatctttcggttcagatgcggtcattatggctacgggtggtccaggc
attatttttggtaaaacaacgaactctatgattaacactgggtcagcagcttcaattgtt
tatcaacaaggtgctaaatatgcaaatggcgaatttattcaaattcatccgactgcgatt
ccaggtgatgacaaattacgtttaatgagtgaatctgcacgtggtgaaggcggtcgtata
tggacatataaagatggtaagccttggtacttcttagaagaaaaatatccggattatggt
aacttagtacctcgtgatattgcaacgcgtgaaatttttgatgtttgtatcaatcaaaaa
ttaggtattaatggtgaaaatatggtgtatctggatctgtctcataaagatccacatgaa
ttagatgttaaattaggtggtatcattgaaatttatgaaaaattcactggtgacgatcct
cgtaaggtaccaatgaagattttcccagcagttcactattcaatgggaggactttatgtt
gattacgatcaaatgaccaacattgatggtttatttgctgcaggagaatgtgatttttca
caacatggaggtaaccgtttaggtgcaaactcattattatctgcaatttatggtggtact
gtcgctggaccaaatgcggtaaaatatgttgaaaatattgataaaacttatgctgattta
gatgattcaatttatcaagcacgggtagatgaagaacaacaaagattcgataatttactt
aatatgcgtggcacagaaaatgcctataaattacatcgtgaactcggtgaaattatgaca
gctaatgttacagttgtaagagaaaatgataaattattggaaaccgataagaaaattgtt
gagctcatggaacgctatcaaaatattgatatggaagatacacagacatggagtaaccaa
gccgtgttctttactcgtcaattatggaatatgcttatacttgcacgtgttatcacaatt
ggtgcttataatcgtaatgaatcacgcggtgcgcattacaaaccagaatttccagaacga
aatgatgaagaatggttaaaaacaacattagcagagtatatgggtaaagatgaagcacca
aaatttacttatgagccagtagatgtaagcttgatcccaccacgtaaacgtgattacact
agcaagtctaaaggaggtaaaaaataa

DBGET integrated database retrieval system