KEGG   Shewanella loihica: Shew_0200Help
Entry
Shew_0200         CDS       T00489                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
slo  Shewanella loihica
Pathway
slo00620  Pyruvate metabolism
slo00680  Methane metabolism
slo01100  Metabolic pathways
slo01120  Microbial metabolism in diverse environments
slo01200  Carbon metabolism
Module
slo_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:slo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Shew_0200
  09102 Energy metabolism
   00680 Methane metabolism
    Shew_0200
Enzymes [BR:slo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Shew_0200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ABO22072
UniProt: A3Q9C4
LinkDB All DBs
Position
complement(211110..213746)
Genome map
AA seq 878 aa AA seqDB search
MTDMYASLRSNVGTLGQILGDTIRTHMDEPFLDKIEQIRHLAKSSRQGNDTAREQMLTLL
AALPDEELVPFAKAFNQFLNLANIAEQFHTISRNCDELVCVPDPVDQLLGRMLNGRIDQD
KMLECLQTLDIDLVLTAHPTEISRRTLIQKYSAVVDCLATMENPQLTEREKKQNHLRLRQ
LIAQIWHTNEIRHERPTPVDEARWGLSTIEASLWQAIPDFLRQLNEQVEERTGKQLPSDI
APIRFSSWMGGDRDGNPFVTAKVTQEVLDRNRHTAARLYLKDVVLLVNELSMEEANEELL
ALTDNSHEPYRVVLRELRQKLRDTIDYLNARLEGHSPEVDLDSLIWHEDDLKQPLTLLYR
SLTESGMSLIANGLLLDMLRRLACFGIHMLRLDIRQDAQRHSDVIAELTRYLGLGDFDHW
DEHEKQAFLLRELSGKRPLIPHNWEPSAEVAEVISTVRLIASQSPKALGSYVISMASQPS
DVLTVLLLLKEAGCQHPMRVVPLFETLEDLNNAASCISALFAIDWYRGYCKGSQEVMIGY
SDSAKDAGVMAAAWAQYSAQEKLVKVCNQADIKLTLFHGRGGTIGRGGGPAHKAILSQPP
GSVDGRIRVTEQGEMIRFKFGLPKLAVQSLALYTSAVMEATLLPPPEPKPEWREAMERLA
SDSVTAYRAIVREEPDFVAYFRAATPEVELGKLPLGSRPAKRRVDGGIESLRAIPWIFAW
SQNRLMLPAWLGAGEALQQAADRGELTLLREMEQQWPFFETRISMLEMVYAKAEPNLAKY
YETCLVPQELHHLGEALRSRMATGIKVVLELTQSDALMSHTPWNRESVELRNPYIDPLNF
LQAELLARTRKEQAGSSNVELALMLTIAGVAAGMRNTG
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atgacagatatgtacgcgtcgctgcgatccaatgtgggcacattaggccaaatattaggc
gatactattcgcacacacatggacgagccctttttagataagattgaacagatcagacac
ctggccaagagctcacgccaaggcaacgataccgccagggaacagatgcttaccctactg
gccgccttacccgacgaagagttggtaccatttgccaaggccttcaaccagtttctcaac
ctggccaatatcgccgagcagttccataccatcagccgcaactgtgacgagctggtctgc
gtgcccgatcctgtggatcaactcctggggcgcatgctaaatgggcgcatcgaccaagat
aagatgctcgagtgtctacagacactggatatcgatctggtgcttacggcgcacccaaca
gagatctcccgtcgcaccctgatccagaaatactccgccgtggtcgattgtctcgccacc
atggaaaacccgcagctcaccgagcgcgaaaagaaacagaatcacctcagactcagacag
cttatcgcccagatctggcacaccaacgagatacgccacgagcgcccaacaccggtggac
gaagcccgctggggactaagcaccatagaggcgtcactctggcaagccattcccgatttt
ctgcgccagctcaacgaacaggtcgaagagcgcaccggtaagcagctgcccagcgacata
gcccccattcgcttctccagctggatgggcggcgatcgcgacggcaaccccttcgtcacc
gccaaagtcacccaggaagtattggatcgcaaccgccacaccgcggcgcgcctctatctc
aaggatgtggtcttgctggtcaacgagctgtcgatggaggaggccaacgaagaactgctg
gcccttacagacaacagccatgaaccttaccgcgtggtgctgcgggagctaagacagaag
ctacgcgacaccatagattatctaaacgcccgcctcgaggggcattcgcccgaggtggat
ctcgatagccttatctggcacgaggacgatctcaaacagcctttgaccctgctctatcgc
agcctgactgagtcaggtatgagcttgatcgccaatggcctgctgctggatatgctgcgt
cgtctggcctgctttggtatccatatgctgcgcctggatatccgccaagatgcccagcgc
catagcgacgtcatcgccgagctgacccgttacctgggccttggcgacttcgaccactgg
gacgaacatgagaaacaagccttcctgctgcgggaactgagtggcaaacgcccgctgatc
ccccataactgggaaccgagtgccgaagttgccgaggtgatcagcaccgtcagattgatc
gccagccagtcgcctaaggccctgggctcctatgtcatctccatggcgagccagccgtcg
gacgtattgactgtgctcctgctattgaaagaggcaggatgtcagcatccgatgcgggtg
gtgccactgttcgagaccttagaggaccttaacaacgccgccagctgtatctcggcgcta
ttcgccatcgactggtaccgcggctactgcaagggcagccaggaggtgatgataggctac
tcagactcggctaaagatgctggcgtaatggcggccgcctgggcacaatacagtgcgcag
gaaaaactggttaaggtctgtaaccaggcagacatcaagctcaccctgttccacggccgt
ggcggcaccataggccgtggcggcggaccagctcacaaggcgatcctgtcgcagccaccg
ggctcggtagatggccgcatcagggtaacggaacaaggagagatgatccgcttcaagttc
ggcctgcctaagttggcagtgcagagcctggcgctatatacctcggccgtgatggaggcc
accctgttgccgccaccagaacctaagccagagtggcgcgaggcgatggagcgactcgcc
agtgactcggtcaccgcctatcgcgccatagtgcgtgaggagccagattttgtcgcctac
ttccgcgcggcaactcctgaagtcgagctcggtaagctaccgctaggtagccgccccgcg
aaacgtcgggtggatggcggtatcgagagcctgcgtgcgatcccctggatcttcgcctgg
tcgcagaaccgcttgatgctccccgcttggctaggcgccggcgaggcgctgcagcaggct
gccgaccgtggcgaactgaccctgctaagggagatggagcaacaatggcccttcttcgag
actcgtatctccatgctagagatggtctacgccaaggccgagcctaacctggcgaagtac
tatgaaacctgcctggtgccgcaagagctacatcatctcggcgaagccctacgtagccgg
atggcgacagggatcaaggtggtcttggagctgacccagtccgatgccctgatgtcgcat
accccgtggaatcgtgagtcggtagagctgcgcaatccctatatcgacccgctcaacttc
ctccaggccgaactcctggcgcgtacccgcaaggagcaggcaggatcaagcaatgtcgaa
ctggcactgatgctcaccatcgccggtgtggcggcgggcatgagaaacacgggttaa

DBGET integrated database retrieval system