KEGG   Shewanella loihica: Shew_0793Help
Entry
Shew_0793         CDS       T00489                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulphide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
slo  Shewanella loihica
Brite
KEGG Orthology (KO) [BR:slo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Shew_0793
Enzymes [BR:slo01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Shew_0793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 GIDA Thioredoxin_3 HI0933_like FAD_oxidored DAO Thi4 AlaDh_PNT_C NAD_binding_7 NAD_binding_8 K_oxygenase FMO-like FAD_binding_3 Glutaredoxin Spermine_synth Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ABO22665
UniProt: A3QB17
LinkDB All DBs
Position
905116..906681
Genome map
AA seq 521 aa AA seqDB search
MLDANVKNQLTTYLQNLKRPVELVVSADERPKAKELLSLATDIAALSELVSLTESVGERT
PSMTVTSPDTGSQIHFAGLPMGHEFTSLVLALLHTGGHPIKLAPEVIEQIRDLPGEYRFE
TYVSLSCQTCPEVVQALNMMSAINPNIQNTMIDGALFQDEVNERNIMAVPSVYLNGEPFS
VGGISVVEILNKLDVNAASRQAEKLSQKEAFDVLVVGGGPAGASAAIYAARKGLRTGILA
DKFGGQVAETVGIENFISVKATEGPKLVANLEAHVHDYDVDIMDNQRALSLKSGELFEIQ
TESGALLRSKTVLLATGARWREMNVPGEKEYRGKGVAYCPHCDGPLFKGKRVAVIGGGNS
GIEAAIDLANIVEHVTVLEFDSKLRADEVLQRKAASMGNIEIITQAMTTEVVGDGTRVQG
LNYTDRATGEQHHVALAGIFVQIGLVPNAEWLKGTVDLSERGEIIVDAKGQTSLPGVFAA
GDVTNSAFKQIIIAMGSGATASLGAFDYLIRLGEPADAEAA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcgaatgtgaaaaatcagctgactacctatctgcaaaacctcaagcgccca
gttgaacttgtcgtatcggcagatgagcgtcctaaagcaaaagagttattgtcgctggca
accgatattgccgcgctttcagaattagtgtcattgaccgaatccgtgggtgagcgtacc
ccgtcgatgacagtgactagccctgacaccggcagtcagatccatttcgccggcctgcca
atgggccatgaatttacctctctggtgctggcgttgctgcacacaggtgggcatccgatc
aagctcgcacccgaagtgatagagcagatccgcgacctgccaggcgagtatcgcttcgag
acctatgtgtcactcagctgtcaaacctgtcccgaggtggtgcaggcgctcaacatgatg
tcggcgatcaaccctaatattcaaaacaccatgatcgatggcgccctgttccaggatgaa
gtgaacgagcgcaacatcatggcggtaccctctgtctacctgaacggcgagccgttttct
gtcggtggcatcagtgtggttgagatcctcaataagctggatgtcaatgcggccagccgt
caggcggaaaagctcagccagaaagaggctttcgacgtgctggtggtcggcggcggcccg
gcgggcgcatcggcagccatctatgcggcccgtaagggactgagaaccggcattctggcg
gacaagtttggtggtcaggtggccgaaaccgtgggcatcgaaaactttatctcggtcaag
gcgaccgaggggcctaagctggtggccaacctggaagcccatgttcacgactatgatgtc
gacatcatggacaatcaacgtgcccttagccttaagtcaggtgagctgtttgagatccag
accgaaagcggcgcactgctgcgcagcaagactgtactactggccacgggcgctcgctgg
cgtgagatgaatgtgccgggtgagaaagagtatcgcggcaaaggcgtcgcctactgccca
cactgtgacggcccgctatttaagggcaagcgcgtggctgtgattggcggtggtaactcg
ggcatagaggcggccatagatctggccaatatcgtcgagcatgttaccgtgctggagttc
gacagcaagctacgcgccgacgaggtgctacagcgtaaggcggcctccatgggcaatatc
gagatcatcacccaggcgatgaccacagaagtggtgggcgatggcacccgggtacaaggc
ctgaactacacagacagagccacgggcgagcagcaccatgttgccctggcgggtatcttt
gtacagataggtctggtgcctaacgccgagtggcttaagggcacggtagatcttagcgaa
cgcggcgaaatcatcgtcgatgctaaaggccagacgtcattgccaggcgtattcgccgcg
ggcgatgtgaccaactctgcctttaaacagatcatcatcgccatgggcagcggcgcgaca
gcctctctgggcgccttcgattacctaatccgtctcggcgagccggcggacgcggaagcc
gcctaa

DBGET integrated database retrieval system