KEGG   Shewanella loihica: Shew_1653Help
Entry
Shew_1653         CDS       T00489                                 

Definition
(GenBank) succinate dehydrogenase subunit A
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
slo  Shewanella loihica
Pathway
slo00020  Citrate cycle (TCA cycle)
slo00190  Oxidative phosphorylation
slo00650  Butanoate metabolism
slo01100  Metabolic pathways
slo01110  Biosynthesis of secondary metabolites
slo01120  Microbial metabolism in diverse environments
slo01130  Biosynthesis of antibiotics
slo01200  Carbon metabolism
Module
slo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
slo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
slo_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:slo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Shew_1653
   00650 Butanoate metabolism
    Shew_1653
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Shew_1653
Enzymes [BR:slo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Shew_1653
    1.3.5.4  fumarate reductase (quinol)
     Shew_1653
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA HI0933_like Pyr_redox_2 DAO FAD_binding_3 FAD_oxidored Thi4
Motif
Other DBs
NCBI-ProteinID: ABO23520
UniProt: A3QDH2
LinkDB All DBs
Position
1899567..1901333
Genome map
AA seq 588 aa AA seqDB search
MSIPVREFDAVVIGAGGAGMRAALQISKEGKSCALLSKVFPTRSHTVSAQGGITVALGNA
HEDHWEQHMYDTVKGSDFIGDQDAIEFMCQTGPEAIIELEHMGLPFSRFDNGKIYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHCLYQQNVKHKTEVFSEWYALDLVKNEDGAIVGC
TAIEIETGEIVYFKSKATILATGGAGRIYASTTNAHINTGDGVGMAMRAGVQMQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKDGERFMERYAPNAKDLASRDVVARSMMTEIREG
RGLDGPLGPHCLLKLDHLGKETLEARLPGVCELSRTFAHIDPADGPIPVLPTCHYMMGGL
PAKVSGQVIRKNEDGSESDVVGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGQHLG
KALDETADPKEASADEIAKSLERLNRWESNKDGEDPAQIRKDLQLCMQLNFSVFRTGEAM
AEGLEELKAIRERLANAKLSDNSREFNTQRIECLELDNLMATAIATAYAANFRQESRGAH
SREDFLERDDENWLCHSLFDPQTEQMTKRAVNMEPKLREAFPPIKRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
gtgagtattccagtacgtgagtttgatgcagtcgtaattggcgccggtggcgcgggtatg
cgagctgcactacagatttctaaagaaggtaagagctgcgcgctgttatctaaagtattc
ccaacgcgttctcataccgtttctgcccagggtggtattaccgttgccctaggtaacgcc
catgaagaccattgggaacagcacatgtacgataccgttaagggttccgacttcatcggt
gatcaagacgcgatcgaatttatgtgtcaaaccggtccagaagccattatcgaacttgag
cacatgggtttgccattctctcgtttcgataacggtaagatctatcagcgtcctttcggc
ggccaatcgaagaacttcggtggcgagcaggcggcacgtaccgctgcggcggcagaccgt
accggtcacgccctgttgcactgtctataccaacagaacgttaagcataagactgaagtc
ttctctgagtggtatgcactggatctggtgaagaacgaagacggtgccatcgtaggttgt
actgcaatcgaaatcgaaaccggcgaaatcgtttacttcaagtctaaggccaccattctg
gctaccggtggtgcgggtcgtatctacgcctctactactaacgctcacatcaacaccggt
gacggtgtcggcatggcaatgcgcgctggcgtgcagatgcaagacatggagatgtggcag
ttccacccaaccggtatcgccggcgcgggtgtactggtaaccgaaggttgtcgtggtgaa
ggcggatacctgctgaacaaagacggcgagcgcttcatggagcgttatgcgccaaacgcg
aaagacctggcctctcgtgacgtggtagcacgttctatgatgactgagatccgtgaaggt
cgtggcctcgacggtccactaggtcctcactgtctactgaaactcgatcacttaggtaaa
gagacgcttgaagcacgcctaccaggcgtttgtgaactgtctcgtaccttcgcgcatatc
gatccagccgatggcccaatccctgtactgccaacctgtcactacatgatgggtggtctg
cctgctaaggtgagcggtcaggtgatccgtaagaatgaagatggcagcgaaagcgatgtc
gttggtctgtttgccgtgggtgagattgcctgtgtatcggtacacggtgcgaaccgcctg
ggtggtaactcactactcgacctcgtggtctttggccgcgcagcgggtcagcacctgggt
aaggcgctggatgagactgccgatcctaaagaagcgagcgccgatgagattgctaagtcg
cttgagcgtctaaatcgttgggaaagcaacaaagacggtgaagatcctgcgcagatccgt
aaagatcttcagctttgtatgcagcttaacttctcggtattccgtaccggcgaggcaatg
gcagaaggtcttgaagagcttaaggcgattcgtgagcgtctggctaatgccaagctgtct
gacaactcaagagagttcaacactcagcgtatcgagtgtctagagctagataacctgatg
gcgacagcaattgcgactgcttatgcggcgaacttccgtcaagagagtcgtggtgcgcat
tcacgtgaagacttcctcgagcgtgatgatgagaactggttgtgtcacagcttgttcgat
cctcagaccgaacagatgaccaagcgtgcggtaaacatggagcctaagcttcgtgaagcc
ttcccgccgattaagcgtacctactaa

DBGET integrated database retrieval system