KEGG   Shewanella loihica: Shew_1654Help
Entry
Shew_1654         CDS       T00489                                 

Definition
(GenBank) succinate dehydrogenase subunit B
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
slo  Shewanella loihica
Pathway
slo00020  Citrate cycle (TCA cycle)
slo00190  Oxidative phosphorylation
slo00650  Butanoate metabolism
slo01100  Metabolic pathways
slo01110  Biosynthesis of secondary metabolites
slo01120  Microbial metabolism in diverse environments
slo01130  Biosynthesis of antibiotics
slo01200  Carbon metabolism
Module
slo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
slo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
slo_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:slo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Shew_1654
   00650 Butanoate metabolism
    Shew_1654
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Shew_1654
Enzymes [BR:slo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Shew_1654
    1.3.5.4  fumarate reductase (quinol)
     Shew_1654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_7 Fer4_18 Fer4_16 Fer4 Fer4_9
Motif
Other DBs
NCBI-ProteinID: ABO23521
UniProt: A3QDH3
LinkDB All DBs
Position
1901344..1902051
Genome map
AA seq 235 aa AA seqDB search
MNLKIAIYRYNPEVDTKPYMKDYTLEVADGTDMMVLDVLMQLKVQDPTLAFRRSCREGVC
GSDGVNMNGKNGLACITPISTFKGKKLEIRPLPGMPVVRDLIVDLTQFYKQYEKIKPYLI
NDDKTPAREHLQSPEERAHLDGLYECIMCACCSTACPSFWWNPDKFIGPSGLLHAYRFLI
DSRDTATEERLSELDDAYSVFRCHGIMNCVDVCPKGLNPTKAIGHIKSMLLKRAV
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgaagattgctatttatcgctataatcctgaagtagacactaagccttacatg
aaggattacacgctagaagtggctgacggtaccgatatgatggtgctggatgtcctgatg
cagctgaaggtacaagacccaacgctggcgttccgtcgctcatgccgtgaaggtgtttgt
ggtagtgatggggtaaacatgaacggtaagaacggtctggcctgtatcacaccaatttct
accttcaagggtaagaagctggagatacgtccactaccgggtatgcctgtggttcgtgac
ctgattgttgacctgactcagttctacaagcagtacgagaagatcaagccttacctgatc
aacgacgacaagacaccggcccgtgaacatctgcaatcgccagaagagcgtgcgcacctg
gacggtctgtatgagtgtatcatgtgtgcgtgttgttcaacggcttgtccatcattctgg
tggaacccagacaagttcatcggtccaagcggcctgttgcatgcctatcgtttccttatc
gatagccgcgataccgccaccgaagagcgtctgtctgagctcgacgatgcttacagcgta
ttccgttgccatggcatcatgaactgtgttgacgtttgtcctaaaggactcaacccgact
aaagcaattggacacatcaagtctatgctgcttaagcgagctgtctaa

DBGET integrated database retrieval system