KEGG   Shewanella loihica: Shew_1962Help
Entry
Shew_1962         CDS       T00489                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
slo  Shewanella loihica
Pathway
slo00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:slo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Shew_1962
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:slo01002]
    Shew_1962
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:slo01011]
    Shew_1962
Enzymes [BR:slo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Shew_1962
   3.4.21  Serine endopeptidases
    3.4.21.-  
     Shew_1962
Peptidases [BR:slo01002]
 Serine Peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   Shew_1962
Peptidoglycan biosynthesis and degradation proteins [BR:slo01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   Shew_1962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2 Peptidase_S11 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: ABO23828
UniProt: A3QED0
LinkDB All DBs
Position
complement(2267440..2269071)
Genome map
AA seq 543 aa AA seqDB search
MYTRLTRGLTALPLNFPSLLTKAIPAAKPFALSLAIAASLIPAASNARADANTNTNSNSN
TKQLDSKGYDNQSYYDNLLSVIAPPHSQLSIFAQDLSNNEILYQHNADTLVLPASTQKLL
TAVAAMRVLGEEFSFATQFSTKGRLSHGVLTGDLYLSFSGDPTLTTDDLRAMLKSLKDAG
IHTVKGNLLLVGQAKEQTRAPGWVWDDLGICYAAPVSSFIVNQNCVKGQLKPKLASSASQ
LNFPRYLPIKVSTTAVFDKTQQEPFCELNLARLPDNHYHISGCYPGDKPLNLAIAVDDPA
LYAKEMLTRMLKSAHIKMSGQVAIAHRTPIGLKPLVTHKSEGLEALLRTMLLDSDNLIAD
SLFKAVGAHYYKVAENFHAGARAVKAILEADGIDLSHSQIIDGSGLSRYNLISARQLAEV
LGLMAKDEKLRPLIELLPVAGVSGTLNYKRGFHQAPLMNKVSAKTGSMQGVDNLAGYLSL
DASHQILFVVMENGQSQKSKKQSPAPFSALFLQSLLDNQGQIVKSQGNEDVDKKNNPKTL
SAQ
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgtatacaagattgactagagggcttaccgcccttccccttaatttcccaagcttgctg
actaaggcgattccggctgccaagcctttcgccttgtctctagctattgcggcttcctta
atacctgcagcaagcaatgccagagccgacgctaataccaataccaattccaattccaat
accaagcagcttgatagcaagggttatgataatcaaagctattatgacaacctcttgtcg
gtgatcgcgccgcctcactcgcaactgtctatttttgcccaggatctctccaataatgag
atactgtatcagcacaacgccgataccctagtgctgcctgccagtacgcaaaaattactc
acggccgtcgccgctatgcgggtattgggtgaagagttcagctttgcgacccaattctca
accaaagggcgcttgtctcacggtgtgttgacgggcgatctctatctttcctttagtggc
gaccccaccttaaccacagacgatctacgagctatgttaaagagcttgaaagatgctggc
attcataccgttaaagggaacctcttgctcgtggggcaagccaaggagcagacgcgcgcc
cctggctgggtgtgggacgatcttgggatttgctacgccgcgccggtttccagctttatc
gtcaatcaaaattgcgtcaagggccagttaaagccaaagcttgcaagcagcgccagccaa
ctcaactttccgcgatatctgcccatcaaggtgtcgacaaccgcggtatttgataagacg
cagcaagagcccttctgtgaactcaacttagctaggctgccggataatcattaccacatc
agtggctgttatccgggtgataagccgcttaatctagctatcgccgtggatgacccagcg
ctctacgccaaagagatgctaacgcgcatgttaaagagcgcccacatcaaaatgagcgga
caagtggctattgcacacagaacgccgattggccttaagcccttagtgacccacaaatcg
gaaggactcgaggcgctccttcgtaccatgctgctcgattcagataacttgattgccgat
agcctgtttaaagccgtaggcgctcactattacaaggtggcagaaaactttcatgcaggt
gccagggccgttaaggcgatactcgaggcggacgggatagatctcagccactcgcagatc
atcgatggctcgggcctttctcgctataaccttatctcggcccggcaactggccgaggtc
ctgggcctgatggcgaaggatgaaaaattacgccccctcattgagctgctgccggtcgcc
ggggttagcggtaccctcaactataagcgcggctttcatcaagctcccttgatgaataag
gtctcggccaagacgggatcgatgcagggcgtcgataacttggcaggttacctttcactc
gacgcaagtcaccaaatactcttcgtggtcatggaaaatggccagagccagaagagtaag
aaacaaagccctgcgccctttagcgccctcttcctgcaaagcctgctggataatcaaggg
cagatagtcaaaagccaaggcaatgaggacgtggataagaagaacaacccaaaaacgctc
agtgcgcaataa

DBGET integrated database retrieval system