KEGG   Shewanella loihica: Shew_2535Help
Entry
Shew_2535         CDS       T00489                                 

Definition
(GenBank) Pyridoxal-dependent decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
slo  Shewanella loihica
Pathway
slo00250  Alanine, aspartate and glutamate metabolism
slo00410  beta-Alanine metabolism
slo00430  Taurine and hypotaurine metabolism
slo00650  Butanoate metabolism
slo01100  Metabolic pathways
slo01110  Biosynthesis of secondary metabolites
slo01120  Microbial metabolism in diverse environments
slo02024  Quorum sensing
Module
slo_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:slo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Shew_2535
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Shew_2535
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Shew_2535
   00430 Taurine and hypotaurine metabolism
    Shew_2535
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Shew_2535
Enzymes [BR:slo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Shew_2535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS Aminotran_1_2 Tape_meas_lam_C DegT_DnrJ_EryC1 Molybdopterin
Motif
Other DBs
NCBI-ProteinID: ABO24401
UniProt: A3QG03
LinkDB All DBs
Position
2992865..2994505
Genome map
AA seq 546 aa AA seqDB search
MTSKQTRQATASEEALMRIFTLPEAPNSTLGKIEKNLSENLMGFLKESIVAVEKPLTEIE
KDFQAYQIPTAPSFVSDYAEQMMQTLIAHSVHTSAPSFIGHMTSALPYFVLPLSKMMVGL
NQNLVKIETSKAFTPLERQVLGMMHHMVYGQTEEFYQSWMHSASHSLGAFCSGGTVANIT
ALWIARNRLLKPDGDFKGVAQSGLMRALRHYGYDDLAILVSTRGHYSLGKAADLLGIGRD
NIISVPCASDNKVDVAKMREAAEQLAEQNIKVMAIVGVAGTTETGNIDPLDELANLAEQL
GCHFHVDAAWGGASLLSSKYRHLLAGIERADSVTIDAHKQMYVPMGAGMVLFKDPEFANA
IKHHAEYILRKGSKDLGSQTLEGSRPGMAMLVHACLQIIGRDGYEILINNSLEKARYFGE
LIAAQDDFQLVSRPELCLLTYRYVPAKVQAQLNEAVAAGDAARVSEINALLDGLTKFIQK
RQREQGKSFVSRTRIIPANNLEQTSVVFRVVLANPLTSNEILQQVLDEQRDIAKLDDRFL
PKLLAL
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaaaacagacacgacaagcgaccgcctctgaagaggccttgatgcgtattttc
actctgcccgaggcaccgaattcgaccctgggtaagatagagaaaaacctgtcggaaaac
ctgatgggcttcctcaaagagagtatcgtcgcagtcgagaagccgctgaccgaaatagaa
aaagatttccaggcctaccagatccccacagcccccagcttcgtctccgactatgccgag
cagatgatgcagaccctgatcgcccacagcgtgcacacctcggctcccagcttcataggt
catatgacctcggccctgccctatttcgtgctgccactgtcgaagatgatggtgggactc
aaccaaaatctggtgaagatagagacctccaaggccttcacgccgctggagcgccaggtg
ctggggatgatgcaccacatggtctatggccagacagaagagttctaccagagctggatg
cacagcgccagtcactcattaggcgccttctgctccggcggcacggtcgccaacatcacg
gcgctgtggatcgcccgtaaccgtctgttaaagccggacggcgacttcaagggggtggcc
caatctggcctgatgcgagcactgcgccactacggctatgacgatctggccattctggta
tcaactcgaggtcactactccctcggcaaggccgcagatctgttaggcataggccgcgac
aacatcatcagcgtgccctgcgctagcgataacaaggtagatgtggccaagatgcgcgaa
gcggccgagcagttagccgagcagaacatcaaggtgatggcgattgtcggcgtggccggc
accacggagacaggtaatatcgacccgctcgatgagcttgcgaatctcgccgagcagctg
ggttgccacttccatgtggatgccgcctggggtggtgccagcctgctgtcgagcaagtat
cgccacctgttagccggcatagagcgcgccgactcagtcactatcgatgcccacaagcag
atgtacgtgcccatgggcgcaggtatggtgctatttaaagacccggaatttgccaacgcc
atcaaacaccacgccgaatatattctgcgtaagggctcgaaagatctgggtagccagacg
ctggaggggtcacgtcccggcatggccatgctggttcatgcctgcttacagatcatcggc
cgcgacggctatgagatcttaatcaacaacagcctggagaaggcgcgttacttcggcgag
ctgatcgccgctcaggacgattttcagctggtttccaggcctgagctctgcctgctgacc
taccgctatgtgccagccaaggtgcaggcgcagctcaatgaggcggtcgcagccggtgac
gcggcccgtgtgagcgagattaatgcattgcttgacggcctgacaaagtttatccagaag
cgccaacgtgagcagggaaaatccttcgtctcccgtacccgcatcattccagccaataac
ctggagcagacctctgtggtgttccgcgtggtactggccaaccctttgaccagtaatgag
atcttacagcaggtattggatgagcagcgcgacatcgccaagctagacgaccgcttcctg
cctaagctgctggccctatag

DBGET integrated database retrieval system