KEGG   Shewanella loihica: Shew_2935Help
Entry
Shew_2935         CDS       T00489                                 

Definition
(GenBank) peptidoglycan glycosyltransferase
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
slo  Shewanella loihica
Pathway
slo00550  Peptidoglycan biosynthesis
slo01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:slo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Shew_2935
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Shew_2935
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:slo01011]
    Shew_2935
Enzymes [BR:slo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Shew_2935
Peptidoglycan biosynthesis and degradation proteins [BR:slo01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   Shew_2935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: ABO24801
UniProt: A3QH53
LinkDB All DBs
Position
3473788..3475671
Genome map
AA seq 627 aa AA seqDB search
MAPRKRMAMHDHAAEASLFKRRAIFTFACVVVLLSILLGNLYHLQVLSYKDYETRSNDNR
IRVVPVAPSRGLIYDRHGQLLAENQPFYSLELIPEKVKDVPATLDELAKVVELSKDDRES
LVASLKYHRRFKPITVKNRLSEEEVAIFSVNQHRFPGFSIDAGLKRHYPYDGLLTHVLGY
VGRINNRDQAALQRNGQWQNYAATKDIGKQGIEKFYESLLHGMPGHLEEEVNNRGRTIRT
LKSVAPEPGQDIYLTLDLQLQKKAMELLAGRRGSIVAIDPRDGGILAMVSSPSYDPNQFV
HGISSKAYSDLLNARSRPLINRATQGQYAPASTVKPHMALLGLEEKVVTPKTRVWDPGFW
QIPGVERKYRDWKRWGHGWVDVNGALVHSCDTYFYDMAYKTGIDKISNFMQQFGFGERTG
VDIFEESAGNMPSKDWKRLKYNQPWYIGDTISVGIGQGYWTTTPLQLANATAIMANKGER
FVPHLLKSIKNDTVKVDTPVDKMAPVVLKSPHNWQIINEAMRDTAHKSRFVDAGYTAAMK
TGTAQVFSVAEDEKYDAENIDEHLRDNALIVAYAPYEAPRIVLAVVLENAGWGGANAGPV
ARALLDEYMLRDNLPLETAGSPHNERP
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
ttggcgccacgtaaacggatggccatgcatgatcatgccgccgaagcctcgctgttcaaa
cgccgcgccatcttcacctttgcctgcgtggtggtcttgctaagcatactgctaggtaac
ctctatcatctgcaagtcttgtcctacaaggactacgagacccgctccaacgacaaccgc
atccgcgtcgtgcccgtggcgccaagccgcggtttgatctacgacagacacggccaactg
ctggcggagaaccagcccttctactcgctggagctgatcccagagaaggttaaagacgtt
cccgcgaccctggatgaactcgctaaggtcgtcgagctcagcaaggatgacagagaaagc
ctggtcgcctccctcaaataccatcgccgcttcaagccgataacggtcaagaaccgcctg
tcggaggaggaagtggcgatctttagcgttaaccaacacagattccctggcttctccatc
gacgcgggcctgaaacgccactacccctacgatgggctgctgacccatgtgctgggctat
gtgggccgcatcaacaacagggaccaggccgcattgcaacgtaacggccagtggcagaac
tacgccgccaccaaggatatcggcaagcagggaatcgaaaaattttatgagagcctgctg
cacggcatgccgggtcatctcgaagaagaggtcaataaccgcggccgcaccattcgcacc
cttaaatctgtggcgccagagccgggccaggatatctacctgaccctggatcttcagcta
cagaagaaggcgatggagctactggcgggtcgccgcggctcaatcgtggctatcgatcct
cgcgatggcggcatactggccatggtctccagccccagctatgacccgaaccagttcgtg
cacggcatcagctccaaggcctatagcgatctgctcaacgctcgctcacgccctttgatc
aaccgcgccactcagggccaatacgccccggcatcgacggttaagcctcacatggcgctg
ctgggcctggaagagaaggtagtgacccctaagacccgggtgtgggatccaggcttttgg
cagatccccggcgtcgagcgcaagtatcgcgactggaaacgttggggccacggctgggtc
gatgtcaacggcgccctggtgcactcctgtgacacctacttctacgacatggcctacaag
acgggcatagataagatcagcaacttcatgcagcagttcggctttggcgagcgcacaggt
gtcgatatcttcgaggaatcggccggtaacatgccatccaaggactggaagcgcctcaaa
tacaatcagccctggtatatcggcgataccatctcggtggggatcggccagggttactgg
accaccacgccgctgcagctggccaacgccaccgccatcatggccaacaagggcgagcgt
ttcgtgccgcacctgttgaagtcgatcaaaaatgataccgtcaaggtcgacacgccggta
gataagatggcgcccgtggtgcttaagagtccacacaactggcagatcatcaacgaggcg
atgcgagataccgcccataagtcgcgcttcgtcgacgcgggctataccgcggcgatgaag
acgggtaccgcccaggtcttcagtgtagccgaagatgaaaagtatgacgccgaaaatatc
gacgaacacctgagggacaacgccttgatcgtcgcctacgccccctatgaggcgccgcgt
atcgtgctggcagtggtactggaaaacgccggttggggtggcgccaacgcaggccccgtg
gcccgcgccctgctggatgagtatatgcttcgcgataacctgcccttagaaaccgccggg
agcccacacaatgaacgcccatag

DBGET integrated database retrieval system