KEGG   Shewanella loihica: Shew_2939Help
Entry
Shew_2939         CDS       T00489                                 

Definition
(GenBank) Serine-type D-Ala-D-Ala carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
slo  Shewanella loihica
Pathway
slo00550  Peptidoglycan biosynthesis
slo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Shew_2939
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:slo01002]
    Shew_2939
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:slo01011]
    Shew_2939
Enzymes [BR:slo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Shew_2939
Peptidases [BR:slo01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   Shew_2939
Peptidoglycan biosynthesis and degradation proteins [BR:slo01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   Shew_2939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 CytoC_RC Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: ABO24805
UniProt: A3QH57
LinkDB All DBs
Position
3478697..3479869
Genome map
AA seq 390 aa AA seqDB search
MKLLNHSFKTLLLVSSLSITAANAAPVVTPDAPKVAAKAFILMDYNSGQIIAEENAYESL
NPASLTKMMTSYVIGHEIKVGNISPQDKVTISKNAWSKNFPDSSKMFIEVGKQVSVEELN
RGIIIQSGNDACVAMAEHIAGTEDGFVDLMNSWAKQLGMRDSYFENSHGLDSENHKTTAY
DMALLGAALIRDVPEEYRVYSEKSFTYNGIKQYNRNGLLWDKSLNVDGIKTGHTSGAGYN
LVTSATKDGMRLVSVVLGTASESARKAESKKLLNYGFRFFETITPYKAGDSFVTQKIWYG
DRESVDLGVLTDTPITISRGQAKNLEANYELNKELTAPIAKGETVGRIYFQLNGKDIAQF
PLVTLQEVNEGSWFSKLMDYFKQMFASWFN
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaaattactgaatcacagctttaaaacactcctccttgtctcctctctctctatcacg
gcagccaacgcggcacccgttgttacgcctgatgctcctaaggtggcagccaaagccttt
atcctgatggattacaactcgggccagatcatcgccgaagagaatgcctatgagagcctg
aacccagccagtctcaccaagatgatgaccagctacgtgataggccacgagatcaaggtg
ggcaacatctcgccacaagacaaggtgaccattagtaagaatgcctggtcgaagaatttc
cccgactcctccaagatgtttatcgaggtgggcaagcaggtctctgtcgaagagctcaac
cgcggcatcatcattcagtcgggtaacgatgcctgtgtcgccatggccgaacatattgcc
ggcacagaagatggtttcgtggatctgatgaactcctgggccaagcagctgggcatgcgt
gacagctacttcgagaactcccacggcctggactcggaaaatcacaagaccacagcctac
gacatggcactgctgggcgccgcgctgatccgcgacgtacccgaggagtaccgcgtctac
tcggagaagtctttcacctataacggcatcaagcagtacaaccgtaacggtctgctatgg
gacaagagcctgaacgtcgatggcatcaagacgggccacacctcaggcgccggttacaac
ctggtgacttcggcaaccaaagatggcatgcgcctagtgtctgtagtcttgggcaccgcc
agcgagtcggcccgtaaggccgagagcaagaagcttctcaactatggtttccgcttcttc
gagaccatcaccccctacaaggcgggcgacagctttgtaacccagaagatctggtacggt
gacagagaatcagtggatctgggcgtgctgacagatacccccatcaccattagccgtggc
caggcgaaaaacctcgaggccaactacgagctgaacaaggagctgactgccccgatcgcc
aagggtgagacagtaggccgcatctacttccagcttaacggcaaagacattgcccagttc
ccactggtcaccctacaagaggtgaacgaaggcagctggttcagcaagctgatggactac
tttaagcagatgtttgccagctggtttaactaa

DBGET integrated database retrieval system